uPAR/PLAUR Protein, Rat (HEK293, His, Avi)
uPAR/PLAUR Protein, Rat (HEK293, His, Avi) is the recombinant rat-derived uPAR/PLAUR protein, expressed by HEK293, with C-Avi & C-His tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
uPAR/PLAUR Protein, Rat (HEK293, His, Avi) is the recombinant rat-derived uPAR/PLAUR protein, expressed by HEK293, with C-Avi & C-His tag.
Background
uPAR/PLAUR acts as a receptor for urokinase plasminogen activator (uPA), playing a role in localizing and promoting plasmin formation. It also mediates the proteolysis-independent signal transduction activation effects of uPA.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P49616 (L25-G299)
-
Gene ID5329
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PLAUR; Monocyte Activation Antigen Mo3; Plasminogen Activator, Urokinase Receptor; U-PAR; Urokinase Plasminogen Activator Surface Receptor; Urokinase Plasminogen Activator Receptor; UPAR; U-Plasminogen Activator Receptor Form 2; URKR; CD87 Antigen; CD87;
-
AA Sequence
LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG
-
Predicted Molecular Mass
33.1 kDa
-
Molecular Weight
Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
