uPAR/PLAUR Protein, Rat (HEK293, His, Avi)

uPAR/PLAUR Protein, Rat (HEK293, His, Avi) is the recombinant rat-derived uPAR/PLAUR protein, expressed by HEK293, with C-Avi & C-His tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

uPAR/PLAUR Protein, Rat (HEK293, His, Avi) is the recombinant rat-derived uPAR/PLAUR protein, expressed by HEK293, with C-Avi & C-His tag.

Background

uPAR/PLAUR acts as a receptor for urokinase plasminogen activator (uPA), playing a role in localizing and promoting plasmin formation. It also mediates the proteolysis-independent signal transduction activation effects of uPA.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PLAUR; Monocyte Activation Antigen Mo3; Plasminogen Activator, Urokinase Receptor; U-PAR; Urokinase Plasminogen Activator Surface Receptor; Urokinase Plasminogen Activator Receptor; UPAR; U-Plasminogen Activator Receptor Form 2; URKR; CD87 Antigen; CD87;

  • AA Sequence

    LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG

  • Predicted Molecular Mass

    33.1 kDa

  • Molecular Weight

    Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00