VEGF183 Protein, Human (sf9)

VEGF183 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF183 Protein, Human (sf9) is the recombinant human-derived VEGF183 protein, expressed by Sf9 insect cells , with tag free. The total length of VEGF183 Protein, Human (sf9) is 183 a.a., with molecular weight of ~21 KDa.

VEGF183 is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a growth factor active in angiogenesis, vasculogenesis, and endothelial cell growth. VEGF-A induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis, and induces permeabilization of blood vessels. VEGF-A binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, as well as heparan sulfate and heparin. It also binds to the NRP1/neuropilin-1 receptor. When VEGF-A binds to NRP1, it initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. Additionally, VEGF-A binds to the DEAR/FBXW7-AS1 receptor.

Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC). The ED₅₀ for this effect is typically 50-210 ng/mL.

Human

Sf9 insect cells

Tag Free

P15692-3 (A27-R209)

7422  [NCBI]

Partial

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 100 mM Gly, 10 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.