VSNL1 Protein, Human
VSNL1 mediates rhodopsin phosphorylation inhibition in vitro and its activity is dependent on calcium levels. This implies that VSNL1 plays a role in regulating rhodopsin phosphorylation dynamics, which is critical for photoreceptor cell signaling. VSNL1 Protein, Human is the recombinant human-derived VSNL1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
VSNL1 mediates rhodopsin phosphorylation inhibition in vitro and its activity is dependent on calcium levels. This implies that VSNL1 plays a role in regulating rhodopsin phosphorylation dynamics, which is critical for photoreceptor cell signaling. VSNL1 Protein, Human is the recombinant human-derived VSNL1 protein, expressed by E. coli , with tag free.
The VSNL1 protein functions as a regulator of rhodopsin phosphorylation inhibition in vitro, and this regulation is dependent on calcium levels. This suggests that VSNL1 plays a role in modulating the phosphorylation dynamics of rhodopsin, a critical process in the signaling cascade of photoreceptor cells. The calcium-dependent nature of VSNL1's activity implies its responsiveness to intracellular calcium concentrations, potentially linking its function to cellular signaling events or calcium-mediated pathways involved in the regulation of visual processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P62760 (G2-K191)
-
Molecular Construction
-
N-term
-
VSNL1 (G2-K191)
Accession # P62760 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
VSNL1; Visinin Like 1; VILIP; HLP3; Hippocalcin‑Like Protein 3; Visinin‑Like Protein 1; HUVISL1; VILIP‑1; HPCAL3; VLP‑1; Uncharacterized Protein VSNL1; VISL1
-
AA Sequence
GKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
-
Predicted Molecular Mass
22.1 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
