Vitronectin Protein, Human (417a.a)

Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (417a.a) is the recombinant human-derived Vitronectin protein, expressed by E. coli, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (417a.a) is the recombinant human-derived Vitronectin protein, expressed by E. coli, with tag free.

Background

Vitronectin Protein is a multifunctional cell adhesion and spreading factor present in serum and tissues. It interacts with glycosaminoglycans and proteoglycans and acts as a cell-to-substrate adhesion molecule, binding to specific integrins. Additionally, Vitronectin Protein functions as an inhibitor of the terminal cytolytic complement pathway, protecting cell membranes from damage. It also possesses protease-inhibiting activity and is involved in regulating growth hormone-dependent processes, specifically somatomedin-B.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Vitronectin(V62-L478)
      Accession # P04004/AAH05046.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Vitronectin; truncated; VN; S-Protein; Serum-Spreading Factor; V75; VTN

  • AA Sequence

    VTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

  • Predicted Molecular Mass

    47.6 kDa

  • Molecular Weight

    Approximately 46-58 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00