Copy Link Print Information

VSIG8 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines, chemokines and other proteins on T cells, and also suppresses T cell proliferation and differentiation of na茂ve T cells. VSIG8 Protein, Human (HEK293, His) is the recombinant human-derived VSIG8 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • VSIG8 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines, chemokines and other proteins on T cells, and also suppresses T cell proliferation and differentiation of na茂ve T cells. VSIG8 Protein, Human (HEK293, His) is the recombinant human-derived VSIG8 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines (IL-2, IFN-γ, IL-17, IL-6, and IL-19), chemokines (MCP-1, MCP-10, and IP-10) and other proteins (IGFBP3 and RBP4) on anti-CD3 activated human CD3 T cells. VSIG-8 significantly reduces the production of IFN-γand IL-2 on both CD4 and CD8 T cells in the presence of T-cell receptor signaling. VSIG-8 markedly suppresses anti-CD3-induced human T cell proliferation and profoundly decreases the conversion of naïve CD4+ T cells into Th1 cells[1][2].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P0DPA2 (V22-G263)

  • Gene ID
    391123  [NCBI]
  • Molecular Construction
    • N-term
    • VSIG8 (V22-G263)
      Accession # P0DPA2
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    VSIG8; V-Set And Immunoglobulin Domain Containing 8; V-Set And Immunoglobulin Domain-Containing Protein 8; C1orf204

  • AA Sequence

    VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG

  • Predicted Molecular Mass

    27.9 kDa

  • Molecular Weight

    Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc-HAc, 5% trehalose, pH 4.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Jinghua Wang, et al. VSIG-8 is a co-inhibitory ligand and an immune checkpoint molecule for human T cells. J Immunol 1 May 2018; 200 (1_Supplement): 47.4.

[2]. Baltz AG, et al. The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts. Mol Cell. 2012 Jun 8;46(5):674-90. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • VSIG8 Protein, Human (HEK293, His) Product Image
    1/16
  • VSIG8 Protein, Human (HEK293, His) Product Image