VSNL1 Protein, Human (His)

VSNL1 mediates rhodopsin phosphorylation inhibition in vitro and its activity is dependent on calcium levels. This implies that VSNL1 plays a role in regulating rhodopsin phosphorylation dynamics, which is critical for photoreceptor cell signaling. VSNL1 Protein, Human (His) is the recombinant human-derived VSNL1 protein, expressed by E. coli , with N-6*His labeled tag.

The VSNL1 protein functions as a regulator of rhodopsin phosphorylation inhibition in vitro, and this regulation is dependent on calcium levels. This suggests that VSNL1 plays a role in modulating the phosphorylation dynamics of rhodopsin, a critical process in the signaling cascade of photoreceptor cells. The calcium-dependent nature of VSNL1's activity implies its responsiveness to intracellular calcium concentrations, potentially linking its function to cellular signaling events or calcium-mediated pathways involved in the regulation of visual processes.

Human

E. coli

N-6*His

P62760 (M1-K191)

7447  [NCBI]

Full Length

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.