WFDC1/PS20 Protein, Human (His)
Based on 1 Customer Validation
WFDC1/PS20 protein has growth inhibitory activity and regulates cell proliferation by hindering cell growth processes. Its actions suggest potential effects on various cellular processes in tissue development and homeostasis. WFDC1/PS20 Protein, Human (His) is the recombinant human-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
WFDC1/PS20 protein has growth inhibitory activity and regulates cell proliferation by hindering cell growth processes. Its actions suggest potential effects on various cellular processes in tissue development and homeostasis. WFDC1/PS20 Protein, Human (His) is the recombinant human-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.
Background
WFDC1/PS20 protein exhibits growth inhibitory activity, suggesting its role in regulating cellular proliferation. Through mechanisms not fully elucidated, WFDC1/PS20 appears to impede the progression of cell growth, potentially influencing various cellular processes involved in tissue development and homeostasis. The growth inhibitory function of WFDC1/PS20 underscores its significance in cellular regulatory networks, making it a candidate for further exploration in understanding the intricate control mechanisms governing cell proliferation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-8*His
-
Accession
Q9HC57 (K32-Q220)
-
Molecular Construction
-
N-term
-
8*His
-
WFDC1 (K32-Q220)
Accession # Q9HC57 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
WFDC1; WAP Four-Disulfide Core Domain 1; PS20; WAP Four-Disulfide Core Domain Protein 1; Prostate Stromal Protein Ps20; Ps20 Growth Inhibitor; WAP Four-Disulfide Core Domain 1 Homolog
-
AA Sequence
KNIWKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ
-
Predicted Molecular Mass
22 kDa
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 200 mM L-arginine, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
