WFDC1/PS20 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

WFDC1/PS20 protein inhibits growth. WFDC1/PS20 Protein, Mouse (His) is the recombinant mouse-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

WFDC1/PS20 protein inhibits growth. WFDC1/PS20 Protein, Mouse (His) is the recombinant mouse-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.

Background

WFDC1/PS20 protein exhibits growth inhibitory activity.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • WFDC1 (Q24-P211)
      Accession # Q9ESH5
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Ps20; Wfdc1

  • AA Sequence

    QGTWEAMLPARLAEKSRAEEVAATGSRQPHADRCPPPPRTLPPGACQATRCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAETCSTTEDGAEPLLCPSGYECHILQPGDEAQGIPNHGQCVKQRRQAEGRVLRQRLHKEYPEGDSKNVAEPGKGQQRHFP

  • Predicted Molecular Mass

    21.9 kDa

  • Molecular Weight

    Approximately 27-30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.

    • Experimental Validation Results for WFDC1/PS20 Protein, Mouse (His)
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL