WFDC1/PS20 Protein, Mouse (His)

WFDC1/PS20 protein inhibits growth. WFDC1/PS20 Protein, Mouse (His) is the recombinant mouse-derived WFDC1/PS20 protein, expressed by E. coli , with N-His labeled tag.

WFDC1/PS20 protein exhibits growth inhibitory activity.

Mouse

E. coli

N-8*His

Q9ESH5 (Q24-P211)

67866  [NCBI]

Full Length of Mature Protein

QGTWEAMLPARLAEKSRAEEVAATGSRQPHADRCPPPPRTLPPGACQATRCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAETCSTTEDGAEPLLCPSGYECHILQPGDEAQGIPNHGQCVKQRRQAEGRVLRQRLHKEYPEGDSKNVAEPGKGQQRHFP

Approximately 27-30 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.