WIF-1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway.In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development.WIF-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived WIF-1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway.In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development.WIF-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived WIF-1 protein, expressed by HEK293 , with C-His labeled tag.
Background
The WIF-1 protein plays a crucial role as it binds to WNT proteins, effectively inhibiting their activities. This interaction suggests a pivotal regulatory function in WNT signaling pathways. Beyond its inhibitory role, WIF-1 may also be involved in mesoderm segmentation, hinting at its potential contributions to embryonic development. Furthermore, WIF-1 interacts with MYOC, indicating a possible association with additional cellular processes or signaling cascades. The multifaceted interactions of WIF-1 underscore its importance in modulating WNT-mediated activities and its potential involvement in broader developmental and cellular events.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9WUA1 (G29-W379)
-
Molecular Construction
-
N-term
-
WIF-1 (G29-W379)
Accession # Q9WUA1 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Wnt inhibitory factor 1; WIF-1; WIF1; UNQ191; PRO217
-
AA Sequence
GQPPEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILRTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKRYGASLMHAPRPAGAGLERHTPSLKKAEDRRDPPESNYIW
-
Predicted Molecular Mass
39.8 kDa
-
Molecular Weight
Approximately 44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
