Aminopeptidase P2 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Aminopeptidase P2 Protein, Rat (HEK293, His) is the recombinant rat-derived Aminopeptidase P2 protein, expressed by HEK293, with C-His tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Aminopeptidase P2 Protein, Rat (HEK293, His) is the recombinant rat-derived Aminopeptidase P2 protein, expressed by HEK293, with C-His tag.
Background
Aminopeptidase P2 is a membrane-bound metalloprotease that catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro. It may play a role in the metabolism of the vasodilator bradykinin.
Verified Bioactivity
Measured by its ability to cleave the fluorogenic peptide substrate, H-Lys(2-Aminobenzoyl)-Pro Pro-p-Nitroanilide (K(Abz)PP-pNA). The specific activity is 664 pmol/min/µg.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-8*His
-
Accession
Q99MA2 (P23-A650)
-
Gene ID117522
-
Protein Length
Full Length of Mature Protein
-
Synonyms
XPNPEP2; X-Prolyl Aminopeptidase 2; Xaa-Pro Aminopeptidase 2; Membrane-Bound Aminopeptidase P; X-Prolyl Aminopeptidase (Aminopeptidase P) 2; Membrane-Bound; Aminoacylproline Aminopeptidase; X-Pro Aminopeptidase 2; Membrane-Bound APP; Membrane-Bound AmP; MAmP; AEACE
-
AA Sequence
PGPESLGREDVRDCSTNPPRLPVTAVNTTMRLAALRQQMEKSNLSAYIIPDTDAHMSEYIGKHDERRAWISGFTGSAGTAVVTKKKAAVWTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGENVGFDPFLFSVGSWENYDQELQDSNRHLLSITTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAIRSYMQNHTMAPTGVLLSALDETAWLFNLRSSDIPYNPFFYSYTLLTDSSIRLFVNKSRFSLETLQYLNTNCTLPMCVQLEDYSQIRDGVKAYASGNVKILIGISYTTYGVYDVIPKEKLVTETYSPVMLIKAVKNSKEQALLKASHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAEHIDQLRRNENFSSGPSFETISASGLNAALAHYSPTKELHRKLSLDEMYLVDSGGQYWDGTTDITRTVHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVVEAFARRALWEVGLNYGHGTGHGIGNFLCVHEWPVGFQYNNMAMAKGMFTSIEPGYYQDGEFGIRLEDVALVVEAKTKYPGTYLTFELVSFVPYDRNLIDVSLLSPEQLQYLNRYYQTIRENIGPELQRRQLLEEFAWLERHTEPLSA
-
Predicted Molecular Mass
72.1 kDa
-
Molecular Weight
Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
