Aminopeptidase P2 Protein, Rat (HEK293, His)

Aminopeptidase P2 Protein, Rat (HEK293, His) is the recombinant rat-derived Aminopeptidase P2 protein, expressed by HEK293, with C-His tag.

Aminopeptidase P2 is a membrane-bound metalloprotease that catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro. It may play a role in the metabolism of the vasodilator bradykinin.

Measured by its ability to cleave the fluorogenic peptide substrate, H-Lys(2-Aminobenzoyl)-Pro Pro-p-Nitroanilide (K(Abz)PP-pNA). The specific activity is 664 pmol/min/µg.

Rat

HEK293

C-8*His

Q99MA2 (P23-A650)

117522

Full Length of Mature Protein

PGPESLGREDVRDCSTNPPRLPVTAVNTTMRLAALRQQMEKSNLSAYIIPDTDAHMSEYIGKHDERRAWISGFTGSAGTAVVTKKKAAVWTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGENVGFDPFLFSVGSWENYDQELQDSNRHLLSITTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAIRSYMQNHTMAPTGVLLSALDETAWLFNLRSSDIPYNPFFYSYTLLTDSSIRLFVNKSRFSLETLQYLNTNCTLPMCVQLEDYSQIRDGVKAYASGNVKILIGISYTTYGVYDVIPKEKLVTETYSPVMLIKAVKNSKEQALLKASHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAEHIDQLRRNENFSSGPSFETISASGLNAALAHYSPTKELHRKLSLDEMYLVDSGGQYWDGTTDITRTVHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVVEAFARRALWEVGLNYGHGTGHGIGNFLCVHEWPVGFQYNNMAMAKGMFTSIEPGYYQDGEFGIRLEDVALVVEAKTKYPGTYLTFELVSFVPYDRNLIDVSLLSPEQLQYLNRYYQTIRENIGPELQRRQLLEEFAWLERHTEPLSA

Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.