XTP3TPA Protein, Human (His)
Based on 1 Customer Validation
XTP3TPA protein crucially hydrolyzes deoxynucleoside triphosphates (dNTPs), particularly preferring dCTP and its analogs, like 5-iodo-dCTP and 5-methyl-dCTP. This selective hydrolysis, reflecting high efficiency, likely safeguards against the incorporation of genotoxic nucleotide analogs into DNA or RNA, contributing to genomic integrity and protecting cellular nucleotide pools. XTP3TPA Protein, Human (His) is the recombinant human-derived XTP3TPA protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
XTP3TPA protein crucially hydrolyzes deoxynucleoside triphosphates (dNTPs), particularly preferring dCTP and its analogs, like 5-iodo-dCTP and 5-methyl-dCTP. This selective hydrolysis, reflecting high efficiency, likely safeguards against the incorporation of genotoxic nucleotide analogs into DNA or RNA, contributing to genomic integrity and protecting cellular nucleotide pools. XTP3TPA Protein, Human (His) is the recombinant human-derived XTP3TPA protein, expressed by E. coli , with N-His labeled tag.
XTP3TPA protein plays a crucial role in cellular processes by hydrolyzing deoxynucleoside triphosphates (dNTPs) to their corresponding nucleoside monophosphates. This enzyme exhibits a robust preference for dCTP and its analogs, such as 5-iodo-dCTP and 5-methyl-dCTP, showcasing high efficiency, possibly serving as a protective mechanism against the incorporation of genotoxic nucleotide analogs into DNA or RNA. The selective hydrolysis of these nucleotide triphosphates by XTP3TPA contributes to the maintenance of genomic integrity and may play a role in safeguarding cellular nucleotide pools from potentially harmful analogs.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9H773 (M1-T170)
-
Molecular Construction
-
N-term
-
His
-
XTP3TPA (M1-T170)
Accession # Q9H773 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
DCTPP1; XTP3-Transactivated Gene A Protein; DCTP Pyrophosphatase 1; Deoxycytidine-Triphosphatase 1; XTP3TPA; XTP3-Transactivated Protein A; RS21C6; DCTPase 1; CDA03; MGC5627
-
AA Sequence
MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
