YTFE Protein, E.coli (GST)
YTFE protein is a diiron-containing molecule that is crucially involved in the repair of iron-sulfur clusters under oxidative and nitrosative stress conditions. As a homodimer, YTFE plays a key role in mitigating damage to iron-sulfur clusters, a process necessary to maintain the integrity and function of various proteins within cells. YTFE Protein, E.coli (GST) is the recombinant E. coli-derived YTFE protein, expressed by E. coli , with N-GST labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
YTFE protein is a diiron-containing molecule that is crucially involved in the repair of iron-sulfur clusters under oxidative and nitrosative stress conditions. As a homodimer, YTFE plays a key role in mitigating damage to iron-sulfur clusters, a process necessary to maintain the integrity and function of various proteins within cells. YTFE Protein, E.coli (GST) is the recombinant E. coli-derived YTFE protein, expressed by E. coli , with N-GST labeled tag.
Background
YTFE, a di-iron-containing protein, plays a vital role in the repair of iron-sulfur clusters that are susceptible to damage under conditions of oxidative and nitrosative stress. Operating as a homodimer, YTFE is implicated in cellular responses to environmental stresses that may compromise the integrity of iron-sulfur clusters, critical co-factors in various biological processes. The di-iron centers within YTFE likely contribute to its function as a repair enzyme, facilitating the restoration of damaged iron-sulfur clusters and ensuring the proper functioning of proteins dependent on these clusters for their activities.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-GST
-
Accession
P69506 (M1-E220)
-
Gene ID66671871 [NCBI]
-
Molecular Construction
-
N-term
-
GST
-
YTFE (M1-E220)
Accession # P69506 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ytfE; b4209; JW4167; Iron-sulfur cluster repair protein YtfE; Regulator of cell morphogenesis and NO signaling; RCMNS
-
AA Sequence
MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
-
Predicted Molecular Mass
51.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
