Zika virus E/Envelope Protein (107a.a, sf9, His)
Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication.Zika virus E/Envelope Protein (sf9, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication.Zika virus E/Envelope Protein (sf9, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Genome polyprotein is a series of protein units with similar or different functions that have been widely utilized by single-celled or multi-cellular organisms as concentrators of countless molecular activities. Genome polyprotein is a small protein chain that is covalently linked, and it is a common means of organizing the protein set of viruses (including HIV) in nature. As the signal peptide of NS4B, genome polyprotein is essential for the anti-interferon activity of NS4B. Genome polyprotein inhibits RNA silencing by interfering with host Dicer. Genome polyprotein may play a role in viral budding. Genome polyprotein exerts cytotoxic effects by activating the mitochondrial apoptosis pathway through the M ectodomain. Genome polyprotein may display viral protein activity[1][2].
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
ALU33341 (V593-K699)
-
Gene ID/
-
Molecular Construction
-
N-term
-
Envelope (V593-K699)
Accession # ALU33341 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope protein (Domain III, His)
-
AA Sequence
VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK
-
Predicted Molecular Mass
13 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Kaur V, et al. Polyprotein synthesis: a journey from the traditional pre-translational method to modern post-translational approaches for single-molecule force spectroscopy. Chem Commun (Camb). 2023 Jun 6;59(46):6946-6955. [Content Brief]
[2]. Crépin T, et al. Polyproteins in structural biology. Curr Opin Struct Biol. 2015 Jun;32:139-46.
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
