Zika virus E/Envelope Protein (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag.

Background

Genome polyprotein is a series of protein units with similar or different functions that have been widely utilized by single-celled or multi-cellular organisms as concentrators of countless molecular activities. Genome polyprotein is a small protein chain that is covalently linked, and it is a common means of organizing the protein set of viruses (including HIV) in nature. As the signal peptide of NS4B, genome polyprotein is essential for the anti-interferon activity of NS4B. Genome polyprotein inhibits RNA silencing by interfering with host Dicer. Genome polyprotein may play a role in viral budding. Genome polyprotein exerts cytotoxic effects by activating the mitochondrial apoptosis pathway through the M ectodomain. Genome polyprotein may display viral protein activity[1][2].

Technical Parameters

  • Species Virus
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Envelope (V593-K699)
      Accession # ALU33341
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope protein (Domain III, His)

  • AA Sequence

    VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for Zika virus E/Envelope Protein (HEK293, His)
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL