Zika virus E/Envelope Protein (HEK293, His)
Based on 1 publication(s) in Google Scholar
Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (HEK293, His) is the recombinant Virus-derived Zika virus E/Envelope protein, expressed by HEK293 , with C-His labeled tag.
Background
Genome polyprotein is a series of protein units with similar or different functions that have been widely utilized by single-celled or multi-cellular organisms as concentrators of countless molecular activities. Genome polyprotein is a small protein chain that is covalently linked, and it is a common means of organizing the protein set of viruses (including HIV) in nature. As the signal peptide of NS4B, genome polyprotein is essential for the anti-interferon activity of NS4B. Genome polyprotein inhibits RNA silencing by interfering with host Dicer. Genome polyprotein may play a role in viral budding. Genome polyprotein exerts cytotoxic effects by activating the mitochondrial apoptosis pathway through the M ectodomain. Genome polyprotein may display viral protein activity[1][2].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Immunol Methods
Development of a sensitive sandwich ELISA for the envelope domain III protein of dengue virus type 2. [Abstract]2025 Dec:545:114000. PMID: 41183705
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-His
-
Accession
ALU33341 (V593-K699)
-
Gene ID/
-
Molecular Construction
-
N-term
-
Envelope (V593-K699)
Accession # ALU33341 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Zika virus (ZIKV) (strain Zika SPH2015) ZIKV-E/Envelope protein (Domain III, His)
-
AA Sequence
VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Kaur V, et al. Polyprotein synthesis: a journey from the traditional pre-translational method to modern post-translational approaches for single-molecule force spectroscopy. Chem Commun (Camb). 2023 Jun 6;59(46):6946-6955. [Content Brief]
[2]. Crépin T, et al. Polyproteins in structural biology. Curr Opin Struct Biol. 2015 Jun;32:139-46.
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)