SLC39A1 Protein, Human (GST)
SLC39A1 Protein, Human (GST) is the recombinant human-derived SLC39A1 protein, expressed by E. coli, with N-GST tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SLC39A1 Protein, Human (GST) is the recombinant human-derived SLC39A1 protein, expressed by E. coli, with N-GST tag.
Background
SLC39A1 is a transporter for the divalent cation Zn2+, mediating the influx of Zn2+ into cells from the extracellular space. It functions as the major importer of zinc from circulating blood plasma into prostate cells. by similar: Its roles include serving as a primary zinc importer.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9NY26 (M126-R179)
-
Gene ID27173
-
Molecular Construction
-
N-term
-
GST
-
Q9NY26 ZIP1 (M126-R179)
Accession # -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
SLC39A1; Solute Carrier Family 39 (Zinc Transporter), Member 3; Prev. ZIRTL; Zinc-Iron-Regulated Transporter-Like; ZIP1; Alternative Protein SLC39A1; Solute Carrier Family 39 (Zinc Transporter), Member 1; SLC39A1 Protein; Zrt- And Irt-Like Protein 1; HZIP
-
AA Sequence
MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR
-
Predicted Molecular Mass
33.1 kDa
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
