ZNRF2 Protein, Human (His)
ZNRF2 protein is an E3 ubiquitin protein ligase that plays a crucial role in neuronal transmission and plasticity. It ubiquitinates Na(+)/K(+) ATPase α-1 subunit/ATP1A1, affecting its endocytosis or degradation, which is critical for neuronal function. ZNRF2 Protein, Human (His) is the recombinant human-derived ZNRF2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ZNRF2 protein is an E3 ubiquitin protein ligase that plays a crucial role in neuronal transmission and plasticity. It ubiquitinates Na(+)/K(+) ATPase α-1 subunit/ATP1A1, affecting its endocytosis or degradation, which is critical for neuronal function. ZNRF2 Protein, Human (His) is the recombinant human-derived ZNRF2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
ZNRF2 Protein, an E3 ubiquitin-protein ligase, assumes a crucial role in the establishment and maintenance of neuronal transmission and plasticity. One of its key functions involves the ubiquitination of the Na(+)/K(+) ATPase alpha-1 subunit/ATP1A1, thereby influencing its endocytosis and/or degradation, a process integral to neuronal function. Additionally, ZNRF2 serves as a positive regulator of mTORC1 activation in response to amino acids, operating upstream of both the V-ATPase and Rag-GTPases. This regulatory cascade, however, exhibits a self-regulating feedback mechanism, as mTOR phosphorylation of ZNRF2 leads to its inhibition and subsequent targeting to the cytosol. This intricate interplay highlights ZNRF2's multifaceted role in modulating neuronal processes, emphasizing its significance in neuronal transmission and plasticity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8NHG8 (G2-D242)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
ZNRF2 (G2-D242)
Accession # Q8NHG8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ZNRF2; Zinc/RING Finger Protein 2; Zinc And Ring Finger 2; Zinc And Ring Finger 2, E3 Ubiquitin Protein Ligase; RNF202; RING Finger Protein 202; RING-Type E3 Ubiquitin Transferase ZNRF2; Protein Ells2; E3 Ubiquitin-Protein Ligase ZNRF2; Zinc Finger/RING F
-
AA Sequence
GAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPSASGGAAAAAAAPAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
