2. Membrane Transporter/Ion Channel Neuronal Signaling
  3. TRP Channel
  4. TAT-M2NX

TAT-M2NX (tatM2NX) is a selective inhibitor targeting human TRPM2 channels and exerts inhibitory effects on ischemic stroke. TAT-M2NX reduces H2O2-induced calcium influx via TRPM2 channels. After traumatic brain injury in mice, TAT-M2NX preserves hippocampal long-term potentiation, improves memory function, and reduces infarct volume after middle cerebral artery occlusion, but it shows no effect on female mice. TAT-M2NX can be used in studies related to traumatic brain injury and ischemic stroke.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

TAT-M2NX

TAT-M2NX Chemical Structure

CAS No. : 2126166-03-6

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg In-stock
100 mg   Get quote  
200 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

TAT-M2NX Related Antibodies

Top Publications Citing Use of Products

View All TRP Channel Isoform Specific Products:

View All Isoforms
TRPA1 TRPC3 TRPC4 TRPC5 TRPC6 TRPC7 TRPM8 TRPM2 TRPM3 TRPM4 TRPM7 TRPML1 TRPML2 TRPML3 TRPV1 TRPV2 TRPV3 TRPV4 TRPV6

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

TAT-M2NX (tatM2NX) is a selective inhibitor targeting human TRPM2 channels and exerts inhibitory effects on ischemic stroke. TAT-M2NX reduces H2O2-induced calcium influx via TRPM2 channels. After traumatic brain injury in mice, TAT-M2NX preserves hippocampal long-term potentiation, improves memory function, and reduces infarct volume after middle cerebral artery occlusion, but it shows no effect on female mice. TAT-M2NX can be used in studies related to traumatic brain injury and ischemic stroke[1][2].

IC50 & Target

TRPM2

 

In Vitro

TAT-M2NX (25-100 μM; 2 h) inhibits human TRPM2 channels in a concentration-dependent manner, as measured by reduced H2O2-induced Ca2+ influx in TRPM2-expressing HEK-293 cells[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

TAT-M2NX Related Antibodies
In Vivo

TAT-M2NX (0.2-20 mg/kg; i.v.; single dose at 2 hours after traumatic brain injury (TBI)) prevents TBI-induced memory impairment in male C57Bl/6 mice at doses of 2, 10 or 20 mg/kg, preserves hippocampal LTP in mice at 7 days post-TBI at doses of 2 or 10 mg/kg, and reduces brain lesion volume; the strongest beneficial effects are observed at the dose of 10 mg/kg[1].
TAT-M2NX (20 mg/kg; retro-orbital injection; single administration) exerts cerebral ischemia-specific neuroprotective effects in male mice: when administered prior to middle cerebral artery occlusion (MCAO), it reduces infarct volume[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: C57Bl/6 (adult 2-4 month, male)[1]
Dosage: 0.2 mg/kg; 2 mg/kg; 10 mg/kg; 20 mg/kg
Administration: i.v.; single dose at 2 hours post-TBI
Result: Did not affect hippocampal LTP, with a normalized fEPSP slope of 129.9%, which was not significantly different from control-treated TBI mice.
Preserved hippocampal LTP, with a normalized fEPSP slope of 165.5%, and prevented TBI-induced memory impairment, with freezing behavior of 47.9%.
Preserved hippocampal LTP, with a normalized fEPSP slope of 186.9%, and prevented TBI-induced memory impairment, with freezing behavior of 52.1%.
Prevented TBI-induced memory impairment, with freezing behavior of 62.3%, which was equivalent to the effect of 10 mg/kg.
Animal Model: C57Bl/6 (young adult, 2-3 month old, male, wild-type; TRPM2−/− (young adult, 2-3 month old, male, knockout))[2]
Dosage: 20 mg/kg
Administration: retro-orbital; single dose (20 min prior to MCAO; 3 h after reperfusion)
Result: Reduced mean infarct volume to 29.2% in wild-type mice treated 20 min prior to MCAO. Reduced mean infarct volume to 28.3% (24 h post-reperfusion) and 23.8% (96 h post-reperfusion) in wild-type mice treated 3 h after reperfusion. Showed no further reduction in infarct volume (27.3%) in TRPM2−/− knockout mice compared to untreated TRPM2−/− knockout mice (27.3%).
Molecular Weight

4354.11

Formula

C190H323N71O45S
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val
Sequence Shortening

YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 50 mg/mL (11.48 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2297 mL 1.1483 mL 2.2967 mL
5 mM 0.0459 mL 0.2297 mL 0.4593 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.55%

SDS (252 KB)

COA (243 KB) RP-HPLC (112 KB) MS (214 KB)

Handling Instructions (2659 KB)
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2297 mL 1.1483 mL 2.2967 mL 5.7417 mL
5 mM 0.0459 mL 0.2297 mL 0.4593 mL 1.1483 mL
10 mM 0.0230 mL 0.1148 mL 0.2297 mL 0.5742 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

TAT-M2NX Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

TAT-M2NX2126166-03-6tatM2NXTRP ChannelTransient receptor potential channelsTRPM2 channelHEK-293 cellstraumatic brain injuryhuman TRPM2 channelsischemic strokemale micehydrogen peroxide-induced calcium influxC57Bl/6 micehippocampal long-term potentiationmiddle cerebral artery occlusionInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TAT-M2NX
Cat. No.:
HY-P5883
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.