Tau Peptide (306-336) (Repeat 3 Domain)

Cat. No.: HY-P4966 Purity: 95.35%: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

Tau Peptide (306-336) (Repeat 3 Domain) is aTau fragment.

For research use only. We do not sell to patients.

Tau Peptide (306-336) (Repeat 3 Domain) Chemical Structure

CAS No. : 330456-26-3

Size	Stock	Quantity
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	Get quote
100 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
Customer Review

Description

Tau Peptide (306-336) (Repeat 3 Domain) is aTau fragment.

Molecular Weight

3247.73

Formula

C₁₄₃H₂₃₆N₄₂O₄₂S

CAS No.

330456-26-3

Appearance

Solid

Color

White to light yellow

Sequence

Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-Leu-Ser-Lys-Val-Thr-Ser-Lys-Cys-Gly-Ser-Leu-Gly-Asn-Ile-His-His-Lys-Pro-Gly-Gly-Gly-Gln

Sequence Shortening

VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

H₂O : ≥ 100 mg/mL (30.79 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.3079 mL	1.5395 mL	3.0791 mL
5 mM	0.0616 mL	0.3079 mL	0.6158 mL
10 mM	0.0308 mL	0.1540 mL	0.3079 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 95.35%

Select Batch:

Data Sheet (250 KB) SDS (254 KB)

COA (257 KB) RP-HPLC (113 KB) MS (198 KB)

Handling Instructions (2659 KB)

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.3079 mL	1.5395 mL	3.0791 mL	7.6977 mL
	5 mM	0.0616 mL	0.3079 mL	0.6158 mL	1.5395 mL
	10 mM	0.0308 mL	0.1540 mL	0.3079 mL	0.7698 mL
	15 mM	0.0205 mL	0.1026 mL	0.2053 mL	0.5132 mL
	20 mM	0.0154 mL	0.0770 mL	0.1540 mL	0.3849 mL
	25 mM	0.0123 mL	0.0616 mL	0.1232 mL	0.3079 mL
	30 mM	0.0103 mL	0.0513 mL	0.1026 mL	0.2566 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.