G-CSF Protein, Rat (HEK293)
Based on 1 publication(s) in Google Scholar
G-CSF Protein, Rat (HEK293) is a glycoprotein, acting to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
G-CSF Protein, Rat (HEK293) is a glycoprotein, acting to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells.
Background
G-CSF is a glycoprotein, secreted by the cells of the immune system, fibroblasts, and endothelium and functions to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells. G-CSF conveys neuroprotection to central neurons upon increases in phosphorylation of PI3K/Akt pathway, and regulates epithelial to mesenchymal transition in cancer[1]. G-CSF acts via a specific cognate receptor (G-CSFR) that belongs to the class I cytokine receptor superfamily. G-CSF is well known as a hematopoietic cytokine that stimulates the proliferation, differentiation, and function of myeloid progenitors and mobilization of hematopoietic stem and progenitor cells[2]. G-CSF has the potential to inhibit the progression of atherosclerosis in animal models[3].
Verified Bioactivity
Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells.The ED50 is ≤ 16.25 pg/mL, corresponding to a specific activity of ≥ 6.15 × 107 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Eur J Med Res
Peripheral Blood-Derived Mesenchymal Stem Cells Promote A2 Phenotype Polarization in Astrocytes via TGF-β-Mediated PI3K/Akt Pathway Activation. [Abstract]2025 Jul 2;30(1):561. PMID: 40605103
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag Tag Free
-
Accession
P97712 (I22-I214)
-
Molecular Construction
-
N-term
-
G-CSF (I22-I214)
Accession # P97712 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CSF3; Filgrastim; Prev. C17orf33; MGC45931; Prev. GCSF; Colony Stimulating Factor 3 Nirs Variant 1; Prev. G-CSF; Granulocyte Colony Stimulating Factor; Granulocyte Colony-Stimulating Factor; Granulocyte-Colony Stimulating Factor; Pluripoietin; Chromosome
-
AA Sequence
IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
-
Predicted Molecular Mass
21.3 kDa
-
Molecular Weight
Approximately 27-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Aliper AM, et al. A role for G-CSF and GM-CSF in nonmyeloid cancers. Cancer Med. 2014 Aug;3(4):737-46. [Content Brief]
[2]. Wright CR, et al. Granulocyte Colony-Stimulating Factor and Its Potential Application for Skeletal Muscle Repair and Regeneration. Mediators Inflamm. 2017;2017:7517350. [Content Brief]
[3]. Liu M, et al. The Effect of Granulocyte Colony-Stimulating Factor on the Progression of Atherosclerosis in Animal Models: A Meta-Analysis. Biomed Res Int. 2017;2017:6705363. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)