HO-1 Protein, Human
Based on 3 publication(s) in Google Scholar
HO-1 Protein, an enzyme, plays a critical role in cellular defense against oxidative stress and inflammation. Dysregulation of HO-1 Protein has been implicated in several diseases, including cardiovascular disorders and neuroinflammatory conditions. Targeting HO-1 Protein may offer potential therapeutic interventions by enhancing antioxidant defenses, reducing inflammation, and potentially treating these diseases. HO-1 Protein, Human is the recombinant human-derived HO-1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
HO-1 Protein, an enzyme, plays a critical role in cellular defense against oxidative stress and inflammation. Dysregulation of HO-1 Protein has been implicated in several diseases, including cardiovascular disorders and neuroinflammatory conditions. Targeting HO-1 Protein may offer potential therapeutic interventions by enhancing antioxidant defenses, reducing inflammation, and potentially treating these diseases. HO-1 Protein, Human is the recombinant human-derived HO-1 protein, expressed by E. coli , with tag free.
Background
The HO-1 protein serves as a catalyst for the oxidative cleavage of heme at the alpha-methene bridge carbon, resulting in the release of carbon monoxide (CO) and the generation of biliverdin IXalpha, while concurrently releasing the central heme iron chelate as ferrous iron. This process has been extensively documented in various publications. Moreover, HO-1 protein plays a crucial role in safeguarding against programmed cell death by catabolizing free heme, thereby preventing its ability to sensitize cells and induce apoptosis. Numerous studies have affirmed the cytoprotective effect of HO-1 protein. Additionally, in the context of microbial infection, it has been observed that during SARS-CoV-2 infection, HO-1 protein promotes SARS-CoV-2 ORF3A-mediated autophagy, although it is not deemed necessary for the induction of reticulophagy by ORF3A.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Int Immunopharmacol
HO-1 relied on PI3K/mTOR signaling to alleviate inflammation by reducing the apoptosis and autophagy of bovine mammary epithelial cells. [Abstract]2026 May 15:177:116545. PMID: 41875495 -
Cell Signal
HO-1 enhances autophagy to alleviate oxidative damage in BMECs via Keap1/Nrf2 and AMPK/mTOR signaling. [Abstract]2026 Sep:145:112578. PMID: 42105892 -
Front Vet Sci
Exploration of the protective mechanisms of Icariin against cisplatin-induced renal cell damage in canines. [Abstract]2024 Feb 21:11:1331409. PMID: 38455257
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P09601 (M1-T261)
-
Molecular Construction
-
N-term
-
HO-1 (M1-T261)
Accession # P09601 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
HMOX1; Heme Oxygenase; Heme Oxygenase 1; HMOX1D; HO-1; HSP32; BK286B10; HO1; Heme Oxygenase (Decycling) 1; HO; Heat Shock Protein, 32-KD
-
AA Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNT
-
Predicted Molecular Mass
29.8 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)