IHH Protein, Human
Based on 1 Customer Validation
IHH Protein, Human is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IHH Protein, Human is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification.
Background
Indian hedgehog (Ihh), which encodes amember of the Hedgehog family of signaling factors, is initially expressed in chondrocytes of the early cartilaginous skeletal elements[1]. Indian Hedgehog is an antagonist of Wnt signaling in colonic epithelial cell differentiation[2]. Ihh is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification. It regulates its effects by feedback control of parathyroid hormone-related peptide (PTHrP) [3].
Verified Bioactivity
1.The ED50 is <3 μg/mL as measured by its ability to induce alkaline phosphatase production by CCL-226 cells.
2.Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 fibroblasts. The ED50 for this effect is typically 2-10 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q14623 (G29-G202)
-
Molecular Construction
-
N-term
-
IHH (G29-G202)
Accession # Q14623 -
C-term
-
-
Protein Length
Full Length of Indian hedgehog protein N-product Chain
-
Synonyms
IHH; Indian Hedgehog (Drosophila) Homolog; Indian Hedgehog Signaling Molecule; Uncharacterized Protein IHH; HHG2; Indian Hedgehog Homolog; BDA1; HHG-2; Indian Hedgehog Protein
-
AA Sequence
GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Van den Brink GR, et al. Indian Hedgehog is an antagonist of Wnt signaling in colonic epithelial cell differentiation. Nat Genet. 2004 Mar;36(3):277-82. Epub 2004 Feb 8. [Content Brief]
[2]. St-Jacques B, et al. Indian hedgehog signaling regulates proliferation and differentiation of chondrocytes and is essential for bone formation. Genes Dev. 1999 Aug 15;13(16):2072-86. [Content Brief]
[3]. Vortkamp A, et al. Regulation of rate of cartilage differentiation by Indian hedgehog and PTH-related protein. Science. 1996 Aug 2;273(5275):613-22. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)