APRIL/TNFSF13 Protein, Mouse
Based on 1 Customer Validation
APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture. APRIL protein has been widely used in the study of lymphatic malignancies. Mouse APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. APRIL/TNFSF13 Protein, Mouse is produced by E. coli (R50-L241) with length of 192 amino acids.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process[1]. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture[2]. APRIL protein has been widely used in the study of lymphatic malignancies. Mouse APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. APRIL/TNFSF13 Protein, Mouse is produced by E. coli (R50-L241) with length of 192 amino acids.
Background
APRIL/TNFSF13 Protein is a cytokine and an independent secretory ligand belongs to TNF family. It binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. APRIL/TNFSF13 Protein plays a role in the regulation of tumor cell growth, may involve in monocyte/macrophage-mediated immunological processes[1].
APRIL is produced by myeloid cells and their precursors in the bone marrow. APRIL is retained by surrounding tissues and via HSPG (heparan sulfate proteoglycans) is not retained. It accumulates in large amounts in the bone marrow, leading to more rapid cell maturation and peripheral burst. As for infection response, tonsil mucosa neutrophils present within the infected tissue were the main source of APRIL, whereas keratinocytes were the primary source of APRIL in tissues showing no symptoms of infection[2].
APRIL acts function by binding BCMA (B cell maturation antigen) and TACI (transmembrane activator and CAML-interactor) and competes with TALL-I (also called BLyS or BAFF) for receptor binding. Soluble BCMA and TACI specifically prevent binding of APRIL and block APRIL-stimulated proliferation of primary B cells, and soluble BCMA is a dominant-negative molecule capable of inhibiting antibody production in vivo. Thus, APRIL stimulates in vitro the proliferation of primary lymphocytes, in addition to lymphoma cell lines, and promotes in vivo the accumulation of B cells in the spleen. Therefore, APRIL-TALL-I and BCMA-TACI form a two ligands-two receptors pathway involved in stimulation of B and T cell function. Moreover, APRIL is also a stimulator of tumor cell growth although TNRF death ligand-1 (TRDL-1), which induces tumor cell apoptosis[1].
It is a type II membrane protein with a cytoplasmic domain, a hydrophobic transmembrane region, and an extracellular domain[2]. Mouse and human APRIL proteins are 82% identical in the COOH-terminal part of the extracellular domain, which contains the presumed receptor-binding domain. And the protein sequences of human and mouse are different with similarity of 80.91%. The APRIL protein is most often studied in the context of lymphoid malignancies[1].
In Vitro
APRIL (mouse; -1 mg/mL) stimulates proliferation of primary B cells[1].
Flag-APRIL (mouse; 1 µg/mL) binds to A2 cells in the absence or presence of threefold excess on a molar basis of a soluble TNFR homolog competitor[1].
Long Flag-APRIL (murine; 5-24 nM) binds to BCMA and TACI with Kd values of 1.31 nM and .6 nM, respectively[1].
Short Flag-APRIL (murine; 11-24 nM) binds to BCMA and TACI with Kd values of .15 nM and 1.5 nM, respectively[1].
In Vivo
APRIL (mouse; 1 mg/kg/d; i.p.; 5 d) results an increase in spleen weight and B cell numbers of mice accompanied by a decrease in those of CD4+ and CD8+ T cells[1].
Verified Bioactivity
Measured by its ability to induce cell proliferation of RPMI 8226 Cells.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9D777 (R50-L241)
-
Molecular Construction
-
N-term
-
APRIL (R50-L241)
Accession # Q9D777 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TNFSF13; ZTNF2; TNF Superfamily Member 13; Tumor Necrosis Factor Ligand Superfamily Member 13 Epsilon; APRIL; Tumor Necrosis Factor-Related Death Ligand-1; Tumor Necrosis Factor Ligand Superfamily Member 13; Tumor Necrosis Factor Superfamily Member 13; A
-
AA Sequence
RREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM acetic acid.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Yu G, et al. APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity. Nat Immunol. 2000 Sep;1(3):252-6. [Content Brief]
[2]. Yamada Y, et al. Identification of TNFSF13, SPATC1L, SLC22A25 and SALL4 as novel susceptibility loci for atrial fibrillation by an exome wide association study. Mol Med Rep. 2017 Nov;16(5):5823-5832. [Content Brief]
[3]. Nowacka KH, et al. Role of the APRIL molecule in solid tumors. Cytokine Growth Factor Rev. 2021 Oct;61:38-44. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)