Animal-Free BAFF/TNFSF13B Protein, Mouse (His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

BAFF/TNFSF13B, is the B cell-activating cytokine belonging to the tumor necrosis factor family. BAFF is involved in cancer immunity and is mainly expressed in myeloid cells. Its overexpression can lead to autoimmune diseases such as systemic lupus erythematosus (SLE). In addition, BAFF is also involved in adipogenesis, atherosclerosis, neuroinflammatory process and ischemia/reperfusion (I/R) injury . Mouse BAFF protein has two glycosylated domains and one transmembrane domain (48-68 a.a.), and can be cleaved into membrane-type peptide fragments and soluble peptide fragments. Animal-Free BAFF/TNFSF13B Protein, Mouse (His) is the extracullar part of BAFF protein (A127-L309), produced in HEK293 cells with C-terminal His-tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

BAFF/TNFSF13B, is the B cell-activating cytokine belonging to the tumor necrosis factor family. BAFF is involved in cancer immunity and is mainly expressed in myeloid cells. Its overexpression can lead to autoimmune diseases such as systemic lupus erythematosus (SLE). In addition, BAFF is also involved in adipogenesis, atherosclerosis, neuroinflammatory process and ischemia/reperfusion (I/R) injury [1]. Mouse BAFF protein has two glycosylated domains and one transmembrane domain (48-68 a.a.), and can be cleaved into membrane-type peptide fragments and soluble peptide fragments. Animal-Free BAFF/TNFSF13B Protein, Mouse (His) is the extracullar part of BAFF protein (A127-L309), produced in HEK293 cells with C-terminal His-tag.This product is for cell culture use only.

Background

B-cell Activating Factor (BAFF), belongs to tumor necrosis factor family, also known as B lymphocyte stimulator (BLyS), dendritic cell-derived TNF-like molecule, and TNF- and APOL-related leukocyte expressed ligand 1 (TALL-1). BAFF is the surpotor of autoreactive B cells, mainly expressed in myeloid cell lines. The expression level of BAFF is important with immunity, while excessive BAFF signaling can lead to autoimmunity. For example, BAFF is commonly overexpressed in Systemic Lupus Erythematosus (SLE). Furthermore, BAFF seems to be involved in adipogenesis, atherosclerosis, neuro-inflammatory processes and ischemia reperfusion (I/R) injury[1]. DeltaBAFF is a conserved alternate splice isoform of BAFF, with a lack of 57 nt encoding the A-A1 loop. DeltaBAFF is co-expressed with BAFF in many mouse and human myeloid cells. DeltaBAFF in mouse is inefficiently released by proteolysis on plasma membrane, and binds to BAFF in heteromultimers to diminish BAFF bioactivity and release. Mouse BAFF protein has two glycosylated domains and one transmembrane domain (48-68 a.a.), and can be cleaved into membrane-type peptide fragments and soluble peptide fragments. Moreover, the protein sequences between human and mice are different with similarity of 68.23%[2]. BAFF also involves in cancer immunity. BAFF upregulates multiple B cell costimulatory molecules; augments IL-12a expression and enhances B cell antigen-presentation to CD4+ Th cells in vitro. it also modulates T cell function through increased T cell activation and TH1 polarization, enhanced expression of the proinflammatory leukocyte trafficking chemokine CCR6, and promotion of a memory phenotype, leading to enhanced antitumor immunity. BAFF has distinct immunoregulatory functions, promoting the expansion of CD4+Foxp3+ Tregs in the spleen and tumor microenvironment (TME)[3].

In Vitro

BAFF (5 μg/mL; 72 h) activated B cells demonstrate enhanced antigen-presentation (APC) to CD4+ Th cells in isolated CD4+ and CD8+ T cells[3].
BAFF (5 μg/mL; 48 h) upregulates multiple B cell costimulatory molecules (CD21, CD23, CD4, CD5, CD8, CD86, ICOS-L, MHCII, and PD-L1) and induces a Be-1 phenotype in B cells[3].

In Vivo

BAFF (mouse; 0.5 mg/kg; i.p.; daily for 7 d) upregulates B cell CD4 and PD-L1 expression in a syngeneic mouse model of melanoma, also increases T cell activation but also induces an increase in Treg frequency[3].

Verified Bioactivity

Measure by its ability to induce proliferation in mouse B cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 106 IU/mg

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • BAFF (A127-L309)
      Accession # Q9WU72
    • 6*His
    • C-term
  • Protein Length

    Full Length of TNFSF13B, soluble form

  • Synonyms

    TNFSF13B; Dendritic Cell-Derived TNF-Like Molecule; Prev. TNFSF20; Tumor Necrosis Factor Ligand 7A; TALL-1; ZTNF4; TALL1; Tumor Necrosis Factor (Ligand) Superfamily, Member 20; BAFF; TNF- And APOL-Related Leukocyte Expressed Ligand 1; BLYS; Tumor Necrosis

  • AA Sequence

    AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL

  • Predicted Molecular Mass

    21.6 kDa

  • Molecular Weight

    Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00