SCF Protein, Mouse (P.pastoris)
Based on 1 Customer Validation
SCF Protein, Mouse (P.pastoris) is the ligand for the receptor-type protein-tyrosine kinase KIT.It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
SCF Protein, Mouse (P.pastoris) is the ligand for the receptor-type protein-tyrosine kinase KIT.It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis.
Embryo implantation is a complex process that requires the interaction of embryo and endometrium. Several growth factors and cytokines appear to be involved in this process. Stem cell factor (SCF) and its receptor c-kit regulate the proliferation and survival of germ cells and play an important role in follicular development. During embryonic development, SCF and c-kit are essential for the survival and proliferation of the germ cell and migration toward the gonad. c-kit mRNA is expressed in the primordial germ cells, while the SCF transcript is expressed along their migratory pathway toward the genital ridge[1].
The ED50 is <10.0 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of >1.0× 105 units/mg.
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag Tag Free
-
Accession
P20826 (K26-A189)
-
Molecular Construction
-
N-term
-
SCF (K26-A189)
Accession # P20826 -
C-term
-
-
Protein Length
Full Length of Soluble KIT ligand
-
Synonyms
KITLG; SLF; Prev. MGF; Familial Progressive Hyperpigmentation 2; SCF; Steel Factor; Mast Cell Growth Factor; C-Kit Ligand; Stem Cell Factor; Kit Ligand; DFNA69; SHEP7; Kitl; DCUA; KL-1; FPHH; FPH2; WS2F; KIT Ligand; SF
-
AA Sequence
KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
