BD-3 Protein, Rat
Based on 1 Customer Validation
BD-3 Protein, Rat is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BD-3 Protein, Rat is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.
Background
Recombinant Rat Beta Defensin-3 is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity. Beta Defensin-3 peptide exhibits broad-spectrum antimicrobial activity, this peptide may serve as an innate defense against microbial invasion at specific mucosal surfaces[1].
Verified Bioactivity
The ED50 is 4-20 μg/mL as measured by its antimicrobial activity against E. coli.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
Q32ZI4 (K23-K63)
-
Gene ID641623 [NCBI]
-
Molecular Construction
-
N-term
-
BD-3 (K23-K63)
Accession # Q32ZI4 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DEFB103A; Defensin-Like Protein; Prev. DEFB103; Beta-Defensin 103; Prev. DEFB3; BD-3; Beta-Defensin 3; Defensin, Beta 103A; DEFB-3; Defensin, Beta 3; HBD3; Beta Defensin 3; HBD-3; Beta Defensin-3; HBP-3; BD3; HBP3; Defensin Beta 103A; Defensin, Beta 103
-
AA Sequence
KKVYNAVSCMTNGGICWLKCSGTFREIGSCGTRQLKCCKKK
-
Predicted Molecular Mass
4.5 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (259 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Recombinant Rat Beta Defensin-3 is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity. Beta Defensin-3 peptide exhibits broad-spectrum antimicrobial activity, this peptide may serve as an innate defense against microbial invasion at specific mucosal surfaces[1]. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)