SULT4A1 Protein, Human

SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone.Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS).SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E.coli , with tag free.

SULT4A1, a member of the atypical sulfotransferase family, exhibits notably low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and displays minimal catalytic activity towards various substrates, including L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. Despite its limited catalytic efficiency, SULT4A1 may play a role in the metabolism of drugs and neurotransmitters within the central nervous system (CNS).

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

Tag Free

Q9BR01 (M1-L284)

25830  [NCBI]

Full Length

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, 150 mM NaCl, 8% sucrose, 0.05% Tween 80, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/hek293-cell.html  [Content Brief]