Des His1, Glu8 Exendin-4
Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. Des His1, Glu8 Exendin-4 improves glucose homeostasis by regulating both insulin secretion and glucose production. Des His1, Glu8 Exendin-4 can be used for the research of type 2 diabetic and gastrointestinal.
For research use only. We do not sell to patients.
- Formula: C179H277N47O59S
- Molecular Weight:4063.46
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Rat[1]
-
Dosage:50 μg, 2 μl/15 s
-
Administration:i3vt injection
-
Result:Showed hyperglycemic for the first 45 min after the intraperitoneal glucose load.
Significantly increased insulin levels and insulin area under the curve (AUC) during the IVGTT.
Chemical Information
-
Molecular Weight 4063.46
-
Formula C179H277N47O59S
-
Sequence Shortening
GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Des His1, Glu8 Exendin-4 Related Classifications
HY-P3542 Related Classifications
Powered by Bioz