1. Others Apoptosis
  2. Apoptosis Isotope-Labeled Compounds
  3. GLP-2(rat) (Ala-13C3,15N) TFA

GLP-2(rat) (Ala-13C3,15N) TFA is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).

Para uso exclusivo en investigación. No vendemos a pacientes.

Síntesis de péptidos personalizados

GLP-2(rat) (Ala-<sup>13</sup>C<sub>3</sub>,<sup>15</sup>N) TFA

GLP-2(rat) (Ala-13C3,15N) TFA Estructura química

Tamaño Stock
1 mg Obtener un presupuesto

* Seleccione Cantidad antes de agregar artículos.

This product is a controlled substance and not for sale in your territory.

Other Forms of GLP-2(rat) (Ala-13C3,15N) TFA:

Top Publications Citing Use of Products
  • Actividad biológica

  • Pureza y Documentación

  • Referencias

  • Revisión del cliente

Descripciòn

GLP-2(rat) (Ala-13C3,15N) TFA is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).

Application

1. This compound can be used as a tracer.
2. This compound can be used as an internal standard for quantitative analysis by NMR, GC-MS, or LC-MS.

In Vitro

Stable heavy isotopes of hydrogen, carbon, and other elements have been incorporated into drug molecules, largely as tracers for quantitation during the drug development process. Deuteration has gained attention because of its potential to affect the pharmacokinetic and metabolic profiles of drugs[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Peso molecular

3800.11 (free acid)

Fòrmula

C16313C3H256N4315NO56S.xC2HF3O2

Unlabeled CAS
Sequence

His-{Ala-13C3,15N}-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp

Sequence Shortening

H-{Ala-13C3,15N}-DGSFSDEMNTILDNLATRDFINWLIQTKITD

Envío

Room temperature in continental US; may vary elsewhere.

Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureza y Documentación
Referencias
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Calculadora de molaridad

  • Calculadora de dilución

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Nombre del producto

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
GLP-2(rat) (Ala-13C3,15N) TFA
Cat. No.:
HY-P1142S1
Cantidad:
MCE Japan Authorized Agent: