GLP-2(rat) (Ala-¹³C₃,¹⁵N)

Cat. No.: HY-P1142S: FAQs
Data Sheet Handling Instructions

Molarity Calculator

GLP-2(rat) (Ala-¹³C3,¹⁵N) is ¹³C and ¹⁵N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-2(rat) (Ala-<sup>13</sup>C<sub>3</sub>,<sup>15</sup>N) Chemical Structure

GLP-2(rat) (Ala-¹³C₃,¹⁵N) Chemical Structure

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of GLP-2(rat) (Ala-¹³C₃,¹⁵N):

GLP-2(rat) In-stock
GLP-2(rat) (Ala-¹³C₃,¹⁵N) (TFA) Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	GLP-2(rat) (Ala-¹³C3,¹⁵N) is ¹³C and ¹⁵N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
In Vitro	Stable heavy isotopes of hydrogen, carbon, and other elements have been incorporated into drug molecules, largely as tracers for quantitation during the drug development process. Deuteration has gained attention because of its potential to affect the pharmacokinetic and metabolic profiles of drugs^[1]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. GLP-2(rat) (Ala-¹³C₃,¹⁵N) Related Antibodies
Molecular Weight	3800.11
Formula	C₁₆₃¹³C₃H₂₅₆N₄₃¹⁵NO₅₆S
Sequence	His-{Ala-13C3,15N}-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
Sequence Shortening	H-{Ala-13C3,15N}-DGSFSDEMNTILDNLATRDFINWLIQTKITD
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (259 KB) Handling Instructions (2659 KB)
References	[1]. Russak EM, et al. Impact of Deuterium Substitution on the Pharmacokinetics of Pharmaceuticals. Ann Pharmacother. 2019 Feb;53(2):211-216. [Content Brief]