(Met(O)35)-Amyloid β-Protein (1-42)
(Met(O)35)-Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met(O)35)-Amyloid β-Protein (1-42) can yield an oligomer size distribution characteristic of Aβ40. (Met(O)35)-Amyloid β-Protein (1-42) can be used in the research of Alzheimer’s disease (AD).
For research use only. We do not sell to patients.
- Formula: C203H311N55O61S
- Molecular Weight:4530.04
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
In Vitro
(Met(O)35)-Amyloid β-Protein (1-42) yields an oligomer size distribution characteristic of Aβ40[1].
(Met(O)35)-Amyloid β-Protein (1-42) can form fibrils faster[1].
.
(Met(O)35)-Amyloid β-Protein (1-42) blocks paranucleus formation and produced oligomers indistinguishable in size and morphology from those produced by Aβ40[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 4530.04
-
Formula C203H311N55O61S
-
Sequence Shortening
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-{Met(O)}-VGGVVIA
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)