(Met(O)35)-Amyloid β-Protein (1-42)

Cat. No.: HY-P3781: Fiche technique Instruction de manipulation
FAQs
Technical Support

(Met(O)35)-Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met(O)35)-Amyloid β-Protein (1-42) can yield an oligomer size distribution characteristic of Aβ40. (Met(O)35)-Amyloid β-Protein (1-42) can be used in the research of Alzheimer’s disease (AD).

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Synthèse de peptides personnalisée

(Met(O)35)-Amyloid β-Protein (1-42) Chemical Structure

Size		Stock
MOQ		Minimum order quantity
50 mg		Obtenir un devis
100 mg		Obtenir un devis
250 mg		Obtenir un devis
Other size		Obtenir un devis

* Veuillez sélectionner la quantité avant d'ajouter des articles.

This product is a controlled substance and not for sale in your territory.

Recommandations en vedette

•Related Small Molecules:

•Related Proteins:

Activité biologique
Pureté et documentation
Références
Avis client

Description	(Met(O)35)-Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met(O)35)-Amyloid β-Protein (1-42) can yield an oligomer size distribution characteristic of Aβ40. (Met(O)35)-Amyloid β-Protein (1-42) can be used in the research of Alzheimer’s disease (AD)^[1].
In Vitro	(Met(O)35)-Amyloid β-Protein (1-42) yields an oligomer size distribution characteristic of Aβ40^[1]. (Met(O)35)-Amyloid β-Protein (1-42) can form fibrils faster^[1]. . (Met(O)35)-Amyloid β-Protein (1-42) blocks paranucleus formation and produced oligomers indistinguishable in size and morphology from those produced by Aβ40^[1]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. (Met(O)35)-Amyloid β-Protein (1-42) Related Antibodies
Masse moléculaire	4530.04
Formule	C₂₀₃H₃₁₁N₅₅O₆₁S
Sequence Shortening	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-{Met(O)}-VGGVVIA
Livraison	Room temperature in continental US; may vary elsewhere.
Stockage	Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation	Fiche technique (259 KB) Instruction de manipulation (2659 KB)
Références	[1]. Bitan G, et al. A molecular switch in amyloid assembly: Met35 and amyloid beta-protein oligomerization. J Am Chem Soc. 2003 Dec 17;125(50):15359-65. [Content Brief]