NEP(1-40), N-terminal uncapped
Based on 1 Customer Validation
NEP(1-40), N-terminal uncapped is a NEP(1-40) (HY-P1242) analog without the acetylation modification at the N-terminal. NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 98.22%
- Formule: C204H322N56O64
- Masse moléculaire:4583.08
-
Stockage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Activité biologique
Chemical Information
-
Appearance Solid
-
Masse moléculaire 4583.08
-
Formule C204H322N56O64
-
Color White to off-white
-
Sequence
Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2
-
Sequence Shortening
RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Pureté et documentation
-
Fiche technique (258 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)