2. Cytoskeleton Protein Tyrosine Kinase/RTK
  3. Integrin VEGFR
  4. Obtustatin

Obtustatin is a non-RGD disintegrin consisting of 41 residues. Obtustatin inhibits the adhesion of α1β1 integrin to type IV Collagen (HY-NP003), blocks α1β1 integrin signaling in endothelial cells, and suppresses FGF2-induced angiogenesis. Obtustatin inhibits tumor progression in mouse models and upregulates VEGF expression in sarcoma-bearing mice. Obtustatin can be used in research related to Lewis lung carcinoma and S-180 sarcoma.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Obtustatin

Obtustatin Chemical Structure

CAS No. : 404882-00-4

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 4 publication(s) in Google Scholar

Other Forms of Obtustatin:

Obtustatin Related Antibodies

Top Publications Citing Use of Products

View All Integrin Isoform Specific Products:

View All Isoforms
αvβ1 αvβ3 αvβ5 αvβ6 αvβ8 α5β1 α1β1 α2β1 α4β1 α9β1 αIIbβ3 α4β7 αLβ2

View All VEGFR Isoform Specific Products:

View All Isoforms
VEGFR1/Flt-1 VEGFR2/KDR/Flk-1 VEGFR3/Flt-4

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Obtustatin is a non-RGD disintegrin consisting of 41 residues. Obtustatin inhibits the adhesion of α1β1 integrin to type IV Collagen (HY-NP003), blocks α1β1 integrin signaling in endothelial cells, and suppresses FGF2-induced angiogenesis. Obtustatin inhibits tumor progression in mouse models and upregulates VEGF expression in sarcoma-bearing mice. Obtustatin can be used in research related to Lewis lung carcinoma and S-180 sarcoma[1][2][3].

In Vitro

Obtustatin potently inhibits the binding of soluble α1β1 integrin to type IV Collagen (HY-NP003), with an IC50 of 0.8 nM[1].
Obtustatin (0-18 nM; 30 min) inhibits the adhesion of α1K562 cells to type IV collagen, with an IC50 of 2 nM[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Obtustatin Related Antibodies
In Vivo

Obtustatin (5 µg/disk; local administration; single dose at 24 hours after initial filter paper placement) potently inhibits FGF2-induced angiogenesis in the chick embryo chorioallantoic membrane (CAM) model[1].
Obtustatin (5 mg/kg; i.p.; once every other day; for 1 week) significantly inhibits the growth of established Lewis lung carcinoma in syngeneic C57BL/6 mice[1].
Obtustatin (1 mg/kg; intratumoral injection; once daily for 5 consecutive days) inhibits the growth of S-180 sarcoma in mice via an anti-angiogenic mechanism associated with the upregulated expression of VEGF, with an inhibition rate of 33%[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: embryos (10-day-old)[1]
Dosage: 5 µg/disk
Administration: topical; single application at 24 hours after initial disk placement
Result: Reduced the FGF2-stimulated angiogenesis index (vessel branch points) from 179 to 79, corresponding to 84% inhibition of angiogenesis.
Animal Model: C57BL/6 (4 animals per group)[1]
Dosage: 5 mg/kg
Administration: i.p.; every other day; 1 week
Result: Reduced tumor volume by approximately 50% after 1 week of treatment compared to control.
Animal Model: unspecified[2]
Dosage: 1 mg/kg
Administration: intratumoral injection; daily; 5 days
Result: Reduced average S-180 sarcoma weight by 33% (average inhibitory rate 32.5%).
Showed no significant weight loss in treated mice.
Increased VEGF expression in treated tumors.
Left expression levels of caspase 8, procaspase 9, caspase 5, and cleaved caspase 3 unchanged relative to controls.
Molecular Weight

4393.06

Formula

C184H284N52O57S8
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Cys-Thr-Thr-Gly-Pro-Cys-Cys-Arg-Gln-Cys-Lys-Leu-Lys-Pro-Ala-Gly-Thr-Thr-Cys-Trp-Lys-Thr-Ser-Leu-Thr-Ser-His-Tyr-Cys-Thr-Gly-Lys-Ser-Cys-Asp-Cys-Pro-Leu-Tyr-Pro-Gly (Disulfide bridge: Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, Cys19-Cys36)
Sequence Shortening

CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG (Disulfide bridge: Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, Cys19-Cys36)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (22.76 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2276 mL 1.1382 mL 2.2763 mL
5 mM 0.0455 mL 0.2276 mL 0.4553 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.94%

SDS (254 KB)

COA (263 KB) RP-HPLC (255 KB) MS (230 KB)

Handling Instructions (2659 KB)
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2276 mL 1.1382 mL 2.2763 mL 5.6908 mL
5 mM 0.0455 mL 0.2276 mL 0.4553 mL 1.1382 mL
10 mM 0.0228 mL 0.1138 mL 0.2276 mL 0.5691 mL
15 mM 0.0152 mL 0.0759 mL 0.1518 mL 0.3794 mL
20 mM 0.0114 mL 0.0569 mL 0.1138 mL 0.2845 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Obtustatin Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Obtustatin404882-00-4IntegrinVEGFRVascular endothelial growth factor receptorα2β1 integrinFGF2human dermal microvascular endothelial cellscollagen IVLewis lung carcinomaS-180 sarcomaendothelial cellsangiogenesisα1β1 integrinchicken chorioallantoic membraneInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Obtustatin
Cat. No.:
HY-P1408
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (254 KB) Français - FR (254 KB) Deutsch - DE (254 KB) Norwegian - NO (254 KB) Español - ES (254 KB) Swedish - SV (254 KB) Italian - IT (254 KB) Korean - KR (254 KB) Portuguese - PT (254 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.