1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins
  3. TNF Superfamily Stimulatory immune checkpoint molecules
  4. TNF Superfamily Ligands 4-1BB (CD137) & 4-1BBL
  5. 4-1BBL/TNFSF9 Protein, Human

4-1BBL/TNFSF9 Protein, Human

Cat. No.: HY-P7113
Handling Instructions

4-1BBL/TNFSF9 Protein, Human is a costimulatory member of the TNF family, which are expressed on activated B cells, macrophages, and dendritic cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

4-1BBL/TNFSF9 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products
  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

C-His

Accession

P41273 (R71-E254)

Gene ID

8744

Synonyms
rHu4-1BBL/TNFSF9; CD137L
AA Sequence

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Weight

Approximately 19.3 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PBS, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

4-1BB Ligand/TNFSF9 is expressed on activated B cells, macrophages, and dendritic cells. 4-1BB Ligand-expressing cell lines or soluble 4-1BB Ligand induce mitogen-activated, CD3-cross-linked, or alloreactive T cells to proliferate and secrete IL-2 in vitro. 4-1BB Ligand is important for the generation of antiviral CD8 T cell responses[1]. 4-1BB Ligand enhances proliferation, cytokine production, and CTL effector function of TCR transgenic T cells. Both CD4 and CD8 T cells respond to 4-1BB ligand (4-1BBL) with similar efficacy[2]. The interaction of 4-1BBL with 4-1BB provides costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-κB, c-Jun and p38 downstream pathways. 4-1BBL can enhance antitumor responses in the absence of CD28, however for protective immunity, CD28:B7 signaling is necessary[3].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BBL/TNFSF9 Protein, Human
Cat. No.:
HY-P7113
Quantity:
MCE Japan Authorized Agent: