AAK1 Protein, Human (Active, His)
Based on 1 Customer Validation
AAK1 Protein, Human (Active, His) is the recombinant human-derived AAK1, expressed by E. coli, with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AAK1 Protein, Human (Active, His) is the recombinant human-derived AAK1, expressed by E. coli, with N-6*His labeled tag.
Background
AAK1 regulates clathrin-mediated endocytosis by phosphorylating the AP2M1/mu2 subunit of the adaptor protein complex 2 (AP-2), ensuring high-affinity binding of AP-2 to cargo membrane proteins during the initial stages of endocytosis. Isoform 1 and isoform 2 exhibit similar levels of kinase activity toward AP2M1 (by similar). AAK1 preferentially phosphorylates substrates on threonine residues and regulates phosphorylation of other AP-2 subunits, as well as AP-2 localization and AP-2-mediated internalization of ligand complexes. Additionally, AAK1 phosphorylates NUMB and regulates its cellular localization, promoting NUMB localization to endosomes. AAK1 also binds to and stabilizes the activated form of NOTCH1, increasing its localization in endosomes and modulating its transcriptional activity.
Verified Bioactivity
The activity was measured by ADP‐Glo™ Kinase Assay. ATP: 25 µM, Substrate: 0.2 mg/mL Micro2 Peptide.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q2M2I8-1 (T27-A365)
-
Gene ID22848
-
Molecular Construction
-
N-term
-
6*His
-
AAK1 (T27-A365)
Accession # Q2M2I8-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
AAK1; KIAA1048; AP2 Associated Kinase 1; Alternative Protein AAK1; AP2-Associated Protein Kinase 1; DKFZp686K16132; Adaptor-Associated Kinase 1
-
AA Sequence
TSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTTETSIA
-
Predicted Molecular Mass
40.2 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris, pH 7.5, 150 mM NaCl, 5% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
/
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
