Copy Link Print Information

ADAMDEC1 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • ADAMDEC1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

Background

ADAM-like Decysin-1 (ADAMDEC1) is a member of the ADAM family and a secreted type of metalloprotease. ADAMDEC1 contains a signal peptide, a prodomain, a catalytic domain, and an incomplete disintegrin domain. ADAMDEC1 contains the ADAM consensus sequence for the proteolytic activity and exhibits a metalloproteinase activity for α2-macroglobulin (α2M) in vitro. The expression of ADAMDEC1 is upregulated in the mix culture of normal and RasV12-transformed epithelial cells, which facilitates apical extrusion of the transformed cells[1].

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O15204 (K206-E470)

  • Gene ID
    27299  [NCBI]
  • Molecular Construction
    • N-term
    • ADAMDEC1 (K206-E470)
      Accession # O15204
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    ADAMDEC1; ADAM-Like Protein Decysin-1; ADAM Like Decysin 1; ADAM DEC1; M12.219; Disintegrin Protease; A Disintegrin And Metalloproteinase Domain-Like Protein Decysin-1; Decysin

  • AA Sequence

    KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

  • Predicted Molecular Mass

    30.3 kDa

  • Molecular Weight

    Approximately 33-41 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filter solution of 20 mM Tris, 150 mM NaCl, 1 mM ZnCl2, pH 7.5 or 20mM Tris-HCl, 150mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Yako Y, et al. ADAM-like Decysin-1 (ADAMDEC1) is a positive regulator of Epithelial Defense Against Cancer (EDAC) that promotes apical extrusion of RasV12-transformed cells. Sci Rep. 2018 Jun 25;8(1):9639. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ADAMDEC1 Protein, Human (HEK293, His) Product Image
    1/16
  • ADAMDEC1 Protein, Human (HEK293, His) Product Image