ADAMDEC1 Protein, Human (HEK293, His)

ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus. ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells and the target gene encoding Ile31-Glu470 is expressed.

ADAM-like Decysin-1 (ADAMDEC1) is a member of the ADAM family and a secreted type of metalloprotease. ADAMDEC1 contains a signal peptide, a prodomain, a catalytic domain, and an incomplete disintegrin domain. ADAMDEC1 contains the ADAM consensus sequence for the proteolytic activity and exhibits a metalloproteinase activity for α2-macroglobulin (α2M) in vitro. The expression of ADAMDEC1 is upregulated in the mix culture of normal and RasV12-transformed epithelial cells, which facilitates apical extrusion of the transformed cells^[1].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

O15204 (K206-E470)

27299  [NCBI]

KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Approximately 38.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM Tris, 150 mM NaCl, 1 mM ZnCl₂, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Yako Y, et al. ADAM-like Decysin-1 (ADAMDEC1) is a positive regulator of Epithelial Defense Against Cancer (EDAC) that promotes apical extrusion of RasV12-transformed cells. Sci Rep. 2018 Jun 25;8(1):9639.  [Content Brief]