Adiponectin/Acrp30 Protein, Human (CHO)
Based on 1 Customer Validation
Adiponectin/Acrp30 Protein, Human (CHO) could increase cell sensitivity to insulin and can be used as a potential protein for studying diabetic tendinopathy
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Adiponectin/Acrp30 Protein, Human (CHO) could increase cell sensitivity to insulin and can be used as a potential protein for studying diabetic tendinopathy
Background
Recombinant Human Adiponectin can be used in the injured artery and attenuates vascular inflammatory response. It is reported that physiological concentrations of Recombinant Human Adiponectin suppress tumor necrosis factor-α(TNF-α)-induced endothelial adhesion molecule expression, transformation from macrophage to foam cell, and TNF-α expression in macrophages[1]. Recombinant Human Adiponectin can be used as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro[2].
Verified Bioactivity
The ED50 is ≤20 μg/mL as measured by M1 cells.
Technical Parameters
-
Species Human
-
Source CHO
-
Tag Tag Free
-
Accession
Q15848 (E19-N244)
-
Molecular Construction
-
N-term
-
Acrp30 (E19-N244)
Accession # Q15848 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ADIPOQ; Adipocyte, C1Q And Collagen Domain Containing; Prev. ACDC; Adipose Specific Collagen-Like Factor; Adiponectin; Gelatin-Binding Protein 28; ACRP30; Gelatin-Binding Protein; GBP28; Adiponectin Precursor; ApM1; ADIPQTL1; Adipose Most Abundant Gene Tr
-
AA Sequence
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
-
Molecular Weight
Approximately 25-28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109(17):2046-9. [Content Brief]
[2]. Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10(13):1899-906. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)