Adiponectin/Acrp30 Protein, Human (HEK293)

Adiponectin/Acrp30 Protein, Human (HEK293) could increase cell sensitivity to insulin and can be used as a potential protein for studying diabetic tendinopathy.

Recombinant Human Adiponectin can be used in the injured artery and attenuates vascular inflammatory response. It is reported that physiological concentrations of Recombinant Human Adiponectin suppress tumor necrosis factor-α(TNF-α)-induced endothelial adhesion molecule expression, transformation from macrophage to foam cell, and TNF-α expression in macrophages^[1]. Recombinant Human Adiponectin can be used as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro^[2].

1.The ED₅₀ is <2 μg/mL as measured by M1 cells.
2.Measured by its ability to induce TIMP-1 secretion by RAW264.7 mouse macrophages cell. The ED₅₀ for this effect is 1.2-5.0 μg/mL.

• 
  Measured by its ability to induce TIMP-1 secretion by RAW264.7 mouse macrophages cell. The ED₅₀ for this effect is 1.312 μg/mL, corresponding to a specific activity is 762.195 U/mg.

Human

HEK293

Tag Free

Q15848 (K101-N244)

9370  [NCBI]

Partial

KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Approximately 16-19 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109(17):2046-9.  [Content Brief]

  [2]. Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10(13):1899-906.  [Content Brief]