Resistin Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Resistin, a hormone linking obesity to diabetes, may hinder insulin's glucose uptake stimulation in adipose cells, contributing to metabolic dysregulation. Additionally, it promotes myeloid cell chemotaxis and forms homodimers through disulfide linkages, interacting with DEFA1. Resistin's involvement in diverse cellular processes suggests its pivotal role in the complex interplay of metabolism, inflammation, and insulin responsiveness. Resistin Protein, Human (His) is the recombinant human-derived Resistin protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Resistin, a hormone linking obesity to diabetes, may hinder insulin's glucose uptake stimulation in adipose cells, contributing to metabolic dysregulation. Additionally, it promotes myeloid cell chemotaxis and forms homodimers through disulfide linkages, interacting with DEFA1. Resistin's involvement in diverse cellular processes suggests its pivotal role in the complex interplay of metabolism, inflammation, and insulin responsiveness. Resistin Protein, Human (His) is the recombinant human-derived Resistin protein, expressed by E. coli , with C-6*His labeled tag.

Background

Resistin, a hormone implicated in connecting obesity to diabetes, exerts its effects by potentially suppressing insulin's ability to stimulate glucose uptake into adipose cells. Not only does it play a role in metabolic regulation, but it also promotes chemotaxis in myeloid cells. Structurally, Resistin forms homodimers through disulfide linkages and interacts with DEFA1, indicating its involvement in diverse cellular processes. This multifaceted hormone emerges as a potential key player in the intricate interplay between metabolism, inflammation, and insulin responsiveness.

Verified Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human Resistin at 0.5 μg/mL (100μL/well) can bind Biotinylated Recombinant Mouse Leptin (HY-P7232). The ED50 for this effect is 79.14 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Resistin (K19-P108)
      Accession # Q9HD89-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    RETN; Cysteine-Rich Secreted Protein FIZZ3; Resistin; RSTN; FIZZ3; C/EBP-Epsilon Regulated Myeloid-Specific Secreted Cysteine-Rich Protein Precursor 1; ADSF; Found In Inflammatory Zone 3; RETN1; Resistin Delta2; C/EBP-Epsilon-Regulated Myeloid-Specific Se

  • AA Sequence

    KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

  • Molecular Weight

    Approximately 10—14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Acetic acid, pH 3.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00