1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. ADPRH/ARH1 Protein, Human (His)

ADPRH/ARH1 Protein, Human (His) is human recombinant ADP-ribosylarginine hydrolase (ADPRH) with a N-terminal His-tag. ADPRH/ARH1 Protein, Human (His) is expressed in E. coli.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

ADPRH/ARH1 Protein, Human (His) is human recombinant ADP-ribosylarginine hydrolase (ADPRH) with a N-terminal His-tag. ADPRH/ARH1 Protein, Human (His) is expressed in E. coli.

Background

ADP-ribosylarginine hydrolase (ADPRH; ARH-1) belongs to the ADP-ribosylglycohydrolase family. ADPRH cleaves α-ADP-ribose-arginine (protein), produced in the transferase-catalyzed reaction, to regenerate the arginine-guanidino group. ADPRH catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. The dysregulation of mono-ADP ribosylation of arginines in proteins by ADPRH can affect cell proliferation and tumorigenesis. ADPRH cDNAs from human, rat, and mouse tissues share 82% similarity of deduced amino acid sequences[1][2].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P54922 (M1-L357)

Gene ID

141  [NCBI]

Molecular Construction
N-term
6*His
ADPRH (M1-L357)
Accession # P54922
C-term
Protein Length

Full Length

Synonyms
rHuADP-ribosylarginine hydrolase, His; ADPRH; ARH-1; ADP-ribosylarginine hydrolase
AA Sequence

MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL

Predicted Molecular Mass
41.7 kDa
분자량

Approximately 39 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filter solution of 20 mM PB, 150 mM NaCl, 50% Glycerol, pH 7.4.
2.Supplied as a 0.22 μm filter solution of PBS, 50% Glycerol, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류
References

ADPRH/ARH1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

ADPRH/ARH1 Protein, Human (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
ADPRH/ARH1 Protein, Human (His)
Cat. No.:
HY-P7462
수량:
MCE Japan Authorized Agent: