ADPRH/ARH1 Protein, Human (His)

ADPRH/ARH1 Protein, Human (His) is human recombinant ADP-ribosylarginine hydrolase (ADPRH) with a N-terminal His-tag. ADPRH/ARH1 Protein, Human (His) is expressed in E. coli.

ADP-ribosylarginine hydrolase (ADPRH; ARH-1) belongs to the ADP-ribosylglycohydrolase family. ADPRH cleaves α-ADP-ribose-arginine (protein), produced in the transferase-catalyzed reaction, to regenerate the arginine-guanidino group. ADPRH catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. The dysregulation of mono-ADP ribosylation of arginines in proteins by ADPRH can affect cell proliferation and tumorigenesis. ADPRH cDNAs from human, rat, and mouse tissues share 82% similarity of deduced amino acid sequences^[1][2].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P54922 (M1-L357)

141  [NCBI]

Full Length

MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL

Approximately 39 kDa,based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

Solution

1.Supplied as a 0.22 μm filter solution of 20 mM PB, 150 mM NaCl, 50% Glycerol, pH 7.4.
2.Supplied as a 0.22 μm filter solution of PBS, 50% Glycerol, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Watanabe K, et al. Enhanced sensitivity to cholera toxin in female ADP-ribosylarginine hydrolase (ARH1)-deficient mice. PLoS One. 2018 Nov 30;13(11):e0207693.  [Content Brief]

  [2]. Kato J, et al. ADP-ribosylarginine hydrolase regulates cell proliferation and tumorigenesis. Cancer Res. 2011 Aug 1;71(15):5327-35.  [Content Brief]