ADPRH/ARH1 Protein, Human (His)
Based on 1 Customer Validation
ADPRH/ARH1 Protein, Human (His) is human recombinant ADP-ribosylarginine hydrolase (ADPRH) with a N-terminal His-tag. ADPRH/ARH1 Protein, Human (His) is expressed in E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
ADPRH/ARH1 Protein, Human (His) is human recombinant ADP-ribosylarginine hydrolase (ADPRH) with a N-terminal His-tag. ADPRH/ARH1 Protein, Human (His) is expressed in E. coli.
Background
ADP-ribosylarginine hydrolase (ADPRH; ARH-1) belongs to the ADP-ribosylglycohydrolase family. ADPRH cleaves α-ADP-ribose-arginine (protein), produced in the transferase-catalyzed reaction, to regenerate the arginine-guanidino group. ADPRH catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. The dysregulation of mono-ADP ribosylation of arginines in proteins by ADPRH can affect cell proliferation and tumorigenesis. ADPRH cDNAs from human, rat, and mouse tissues share 82% similarity of deduced amino acid sequences[1][2].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P54922 (M1-L357)
-
Molecular Construction
-
N-term
-
6*His
-
ADPRH (M1-L357)
Accession # P54922 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ADPRH; ADP-Ribose-L-Arginine Cleaving Enzyme; ADP-Ribosylarginine Hydrolase; ADP-Ribosylhydrolase ARH1; [Protein ADP-Ribosylarginine] Hydrolase; HARH1; ARH1
-
AA Sequence
MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
-
Predicted Molecular Mass
41.7 kDa
-
Molecular Weight
Approximately 39 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
1.Supplied as a 0.22 μm filter solution of 20 mM PB, 150 mM NaCl, 50% Glycerol, pH 7.4.
2.Supplied as a 0.22 μm filter solution of PBS, 50% Glycerol, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Watanabe K, et al. Enhanced sensitivity to cholera toxin in female ADP-ribosylarginine hydrolase (ARH1)-deficient mice. PLoS One. 2018 Nov 30;13(11):e0207693. [Content Brief]
[2]. Kato J, et al. ADP-ribosylarginine hydrolase regulates cell proliferation and tumorigenesis. Cancer Res. 2011 Aug 1;71(15):5327-35. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
