Copy Link Print Information

AG-2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

AG-2 protein is critical for MUC2 post-transcriptional synthesis and secretion, implicating its role in intestinal mucus production. As a proto-oncogene, AG-2 affects cell migration, differentiation, and growth. AG-2 Protein, Human (HEK293, His) is the recombinant human-derived AG-2 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for AG-2 Protein, Human (HEK293, His)
  • Experimental Validation Results for AG-2 Protein, Human (HEK293, His)
  • AG-2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

AG-2 protein is critical for MUC2 post-transcriptional synthesis and secretion, implicating its role in intestinal mucus production. As a proto-oncogene, AG-2 affects cell migration, differentiation, and growth. AG-2 Protein, Human (HEK293, His) is the recombinant human-derived AG-2 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

AG-2 protein is essential for the post-transcriptional synthesis and secretion of MUC2, suggesting a potential involvement in mucus production by intestinal cells. Beyond its role in mucin regulation, AG-2 emerges as a proto-oncogene, exerting influence on cell migration, differentiation, and growth. Notably, AG-2 promotes cell adhesion, underscoring its multifaceted contributions to cellular processes. Structurally, AG-2 exists as both a monomer and a homodimer. Additionally, it interacts with LYPD3 and DAG1 (alphaDAG1), forming complexes that may further modulate its functions. The interaction with MUC2, characterized by disulfide linkages, highlights the intricate molecular relationships AG-2 establishes within the cellular milieu.

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of PC-3 human prostate cancer cells. The ED50 for this effect is 1.723-1.963 μg/mL, corresponding to a specific activity is 509.424-580.383 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of PC-3 human prostate cancer cells. The ED50 for this effect is 1.963 μg/mL, corresponding to a specific activity is 509.424 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    O95994 (R21-L175)

  • Gene ID
    10551  [NCBI]
  • Molecular Construction
    • N-term
    • AG-2 (R21-L175)
      Accession # O95994
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    AGR2; Epididymis Secretory Protein Li 116; Anterior Gradient 2, Protein Disulphide Isomerase Family Member; HEL-S-116; HAG-2; AG-2; AG2; HPC8; PDIA17; Anterior Gradient 2 Splice Variant C; XAG-2; Secreted Cement Gland Homolog; Protein Disulfide Isomerase

  • AA Sequence

    RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

  • Predicted Molecular Mass

    17.8 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of PC-3 human prostate cancer cells. The ED50 for this effect is 1.963 μg/mL, corresponding to a specific activity is 509.424 units/mg.

  • AG-2 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for AG-2 Protein, Human (HEK293, His)
  • Experimental Validation Results for AG-2 Protein, Human (HEK293, His)
  • AG-2 Protein, Human (HEK293, His) Product Image