1. Recombinant Proteins
  2. Others
  3. AG-2 Protein, Mouse (His)

AG-2 protein is a member of the protein disulfide isomerase family and is predicted to bind to dystroglycan, epidermal growth factor receptor, and the same proteins.It plays a role in digestive tract morphogenesis, mucus secretion, and developmental growth regulation.AG-2 Protein, Mouse (His) is the recombinant mouse-derived AG-2 protein, expressed by E.coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AG-2 protein is a member of the protein disulfide isomerase family and is predicted to bind to dystroglycan, epidermal growth factor receptor, and the same proteins.It plays a role in digestive tract morphogenesis, mucus secretion, and developmental growth regulation.AG-2 Protein, Mouse (His) is the recombinant mouse-derived AG-2 protein, expressed by E.coli , with C-His labeled tag.

Background

AG-2, encoding for Anterior Gradient 2, a member of the protein disulfide isomerase family, is anticipated to exhibit dystroglycan binding activity, epidermal growth factor receptor binding activity, and identical protein binding activity. This protein is implicated in diverse biological processes, including digestive tract morphogenesis, mucus secretion, and positive regulation of developmental growth. AG-2 is positioned in the endoplasmic reticulum and displays biased expression in various tissues, with notable prevalence in the large intestine and colon of adults. The orthologous relationship to the human AGR2 underscores its evolutionary conservation, suggesting shared functional roles and potential contributions to cellular and developmental processes.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

NP_035913.1 (K21-L175)

Gene ID
Molecular Construction
N-term
AG-2 (K21-L175)
Accession # NP_035913.1
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Anterior gradient protein 2 homolog; AG-2; AG2; hAG-2; hAG 2; HPC8; AGR2
AA Sequence

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Predicted Molecular Mass
18.8 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

AG-2 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AG-2 Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AG-2 Protein, Mouse (His)
Cat. No.:
HY-P701076
Quantity:
MCE Japan Authorized Agent: