AG-2 Protein, Mouse (His)
AG-2 protein is a member of the protein disulfide isomerase family and is predicted to bind to dystroglycan, epidermal growth factor receptor, and the same proteins.It plays a role in digestive tract morphogenesis, mucus secretion, and developmental growth regulation.AG-2 Protein, Mouse (His) is the recombinant mouse-derived AG-2 protein, expressed by E.coli , with C-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AG-2 protein is a member of the protein disulfide isomerase family and is predicted to bind to dystroglycan, epidermal growth factor receptor, and the same proteins.It plays a role in digestive tract morphogenesis, mucus secretion, and developmental growth regulation.AG-2 Protein, Mouse (His) is the recombinant mouse-derived AG-2 protein, expressed by E.coli , with C-His labeled tag.
Background
AG-2, encoding for Anterior Gradient 2, a member of the protein disulfide isomerase family, is anticipated to exhibit dystroglycan binding activity, epidermal growth factor receptor binding activity, and identical protein binding activity. This protein is implicated in diverse biological processes, including digestive tract morphogenesis, mucus secretion, and positive regulation of developmental growth. AG-2 is positioned in the endoplasmic reticulum and displays biased expression in various tissues, with notable prevalence in the large intestine and colon of adults. The orthologous relationship to the human AGR2 underscores its evolutionary conservation, suggesting shared functional roles and potential contributions to cellular and developmental processes.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-His
-
Accession
NP_035913.1 (K21-L175)
-
Molecular Construction
-
N-term
-
AG-2 (K21-L175)
Accession # NP_035913.1 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
AGR2; Epididymis Secretory Protein Li 116; Anterior Gradient 2, Protein Disulphide Isomerase Family Member; HEL-S-116; HAG-2; AG-2; AG2; HPC8; PDIA17; Anterior Gradient 2 Splice Variant C; XAG-2; Secreted Cement Gland Homolog; Protein Disulfide Isomerase
-
AA Sequence
KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL
-
Predicted Molecular Mass
18.8 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
