1. Recombinant Proteins
  2. Receptor Proteins
  3. AGER Protein, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE AGER Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

Background

AGER (Advanced glycosylation end product-specific receptor), a member of the immunoglobulin superfamily of cell surface molecules, is a transmembrane signal transduction receptor with a number of ligands, including alarmins that can initiate and perpetuate immune responses. AGER naturally exists in two forms that are full-length membrane-bound and truncated (soluble). The human AGER is a highly polymorphic gene with more than 190 SNPs mapped to its locus on the 6p21.3 chromosome. AGER interacts with a broad spectrum of ligands and multiple signaling pathways, such as those activated by the high mobility group box 1 (HMGB1) protein (a non-canonical ligand of AGER). AGER serve as a mediator of both acute and chronic vascular inflammation in certain conditions such as atherosclerosis and in particular as a complication of diabetes[1][2].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human AGER at 5 µg/mL (100 µL/well) can bind biotinylated advanced glycation endproducts of bovine serum albumin (AGE-BSA). The ED50 for this effect is 0.9828 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human AGER at 5 µg/mL (100 µL/well) can bind biotinylated advanced glycation endproducts of bovine serum albumin (AGE-BSA) .The ED50 for this effect is 0.9828 μg/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q15109 (A23-A344)

Gene ID

177  [NCBI]

Molecular Construction
N-term
AGER (A23-A344)
Accession # Q15109
6*His
C-term
Protein Length

Partial

Synonyms
rHuAGER, His; RAGE; AGER
AA Sequence

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Weight

Approximately 55 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

AGER Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AGER Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AGER Protein, Human (HEK293, His)
Cat. No.:
HY-P7467
Quantity:
MCE Japan Authorized Agent: