AGER Protein, Human (HEK293, His)
Based on 2 publication(s) in Google Scholar
AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.
Background
AGER (Advanced glycosylation end product-specific receptor), a member of the immunoglobulin superfamily of cell surface molecules, is a transmembrane signal transduction receptor with a number of ligands, including alarmins that can initiate and perpetuate immune responses. AGER naturally exists in two forms that are full-length membrane-bound and truncated (soluble). The human AGER is a highly polymorphic gene with more than 190 SNPs mapped to its locus on the 6p21.3 chromosome. AGER interacts with a broad spectrum of ligands and multiple signaling pathways, such as those activated by the high mobility group box 1 (HMGB1) protein (a non-canonical ligand of AGER). AGER serve as a mediator of both acute and chronic vascular inflammation in certain conditions such as atherosclerosis and in particular as a complication of diabetes[1][2].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human AGER at 5 µg/mL (100 µL/well) can bind biotinylated advanced glycation endproducts of bovine serum albumin (AGE-BSA). The ED50 for this effect is 0.9828 μg/mL.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
-
Cell Biochem Biophys
Virtual Probing on the Influence of Ca2+ and Zn2+ Bound S100A8 and S100A9 Proteins Towards their Interaction Against Pattern Recognition Receptors Aggravating Rheumatoid Arthritis. [Abstract]2025 Jun;83(2):1919-1941. PMID: 39576489
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q15109 (A23-A344)
-
Molecular Construction
-
N-term
-
AGER (A23-A344)
Accession # Q15109 -
6*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
AGER; Receptor For Advanced Glycosylation End-Products Deletion Exon3-10 Variant; Advanced Glycosylation End-Product Specific Receptor; Receptor For Advanced Glycosylation End-Products Deletion Exon2-6 Variant; RAGE; Advanced Glycosylation End Product-Spe
-
AA Sequence
AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10(7):e0134475. [Content Brief]
[2]. Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37(7):1686-90. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
