AGER Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

AGER proteins have multiple activities, including binding to S100 proteins, advanced glycation end products, and heparin. It is involved in cellular responses to amyloid, regulation of synaptic potentiation, and cytokine production. AGER Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

AGER proteins have multiple activities, including binding to S100 proteins, advanced glycation end products, and heparin. It is involved in cellular responses to amyloid, regulation of synaptic potentiation, and cytokine production. AGER Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

Background

The AGER gene encodes a protein that exhibits S100 protein binding activity, advanced glycation end-product binding activity, and heparin binding activity. Involved in various processes, including cellular response to amyloid-beta, negative regulation of long-term synaptic potentiation, and positive regulation of cytokine production, AGER acts upstream of or within pathways related to induction of positive chemotaxis, negative regulation of advanced glycation end-product receptor activity, and positive regulation of macromolecule metabolic processes. Predominantly located in the extracellular space and plasma membrane, AGER is expressed across diverse structures such as the alimentary system, brain, genitourinary system, hemolymphoid system gland, and lung. Implicated in multiple diseases, including autoimmune diseases, cardiovascular system diseases, cystic fibrosis, kidney failure, and lupus nephritis, the human ortholog of AGER, known as advanced glycosylation end-product specific receptor, plays a crucial role in diverse physiological and pathological contexts. Notably, its expression is particularly enriched in the adult lung.

Verified Bioactivity

Immobilized Recombinant Mouse AGER Protein at 20 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human HMGB1 Protein. The ED50 for this effect is 0.6233-1.298 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Recombinant Mouse AGER Protein at 20 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human HMGB1 Protein. The ED50 for this effect is 0.6233 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • AGER (Q24-A342)
      Accession # Q62151-1/NP_031451.2
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    AGER; Receptor For Advanced Glycosylation End-Products Deletion Exon3-10 Variant; Advanced Glycosylation End-Product Specific Receptor; Receptor For Advanced Glycosylation End-Products Deletion Exon2-6 Variant; RAGE; Advanced Glycosylation End Product-Spe

  • AA Sequence

    QNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALA

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00