AGER Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
AGER proteins have multiple activities, including binding to S100 proteins, advanced glycation end products, and heparin. It is involved in cellular responses to amyloid, regulation of synaptic potentiation, and cytokine production. AGER Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGER protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
AGER proteins have multiple activities, including binding to S100 proteins, advanced glycation end products, and heparin. It is involved in cellular responses to amyloid, regulation of synaptic potentiation, and cytokine production. AGER Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGER protein, expressed by HEK293 , with C-His labeled tag.
Background
The AGER gene encodes a protein that exhibits S100 protein binding activity, advanced glycation end-product binding activity, and heparin binding activity. Involved in various processes, including cellular response to amyloid-beta, negative regulation of long-term synaptic potentiation, and positive regulation of cytokine production, AGER acts upstream of or within pathways related to induction of positive chemotaxis, negative regulation of advanced glycation end-product receptor activity, and positive regulation of macromolecule metabolic processes. Predominantly located in the extracellular space and plasma membrane, AGER is expressed across diverse structures such as the alimentary system, brain, genitourinary system, hemolymphoid system gland, and lung. Implicated in multiple diseases, including autoimmune diseases, cardiovascular system diseases, cystic fibrosis, kidney failure, and lupus nephritis, the human ortholog of AGER, known as advanced glycosylation end-product specific receptor, plays a crucial role in diverse physiological and pathological contexts. Notably, its expression is particularly enriched in the adult lung.
Verified Bioactivity
Immobilized Recombinant Mouse AGER Protein at 20 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human HMGB1 Protein. The ED50 for this effect is 0.6233-1.298 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q62151-1/NP_031451.2 (Q24-A342)
-
Molecular Construction
-
N-term
-
AGER (Q24-A342)
Accession # Q62151-1/NP_031451.2 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
AGER; Receptor For Advanced Glycosylation End-Products Deletion Exon3-10 Variant; Advanced Glycosylation End-Product Specific Receptor; Receptor For Advanced Glycosylation End-Products Deletion Exon2-6 Variant; RAGE; Advanced Glycosylation End Product-Spe
-
AA Sequence
QNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALA
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)