AADAT/alpha-Aminoadipate Aminotransferase Protein, Human (His-SUMO)

The α-aminoadipic acid aminotransferase protein exhibits broad substrate specificity, preferentially selecting aminoadipic acid, kynurenine, methionine, and glutamate as an aminotransferase. It also exhibits transaminase activity toward tryptophan, aspartate, and hydroxykynurenine, and accepts oxygen-containing acids such as 2-oxoglutarate, 2-oxohexanoic acid, phenylpyruvate, and α- Oxo-γ-methylmercaptanbutyric acid. AADAT/alpha-Aminoadipate Aminotransferase Protein, Human (His-SUMO) is the recombinant human-derived alpha-Aminoadipate Aminotransferase protein, expressed by E. coli , with N-6*His-SUMO tag.

The alpha-Aminoadipate Aminotransferase protein demonstrates broad substrate specificity, functioning as a transaminase with activity towards aminoadipate, kynurenine, methionine, and glutamate. This enzyme also exhibits transaminase activity towards tryptophan, aspartate, and hydroxykynurenine. Furthermore, it accepts various oxo-acids as amino-group acceptors, showing a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate, and alpha-oxo-gamma-methiol butyric acid. Notably, alpha-Aminoadipate Aminotransferase can utilize glyoxylate as an amino-group acceptor in vitro, showcasing its versatility in accepting diverse substrates in enzymatic reactions.

Human

E. coli

N-SUMO;N-6*His

Q8N5Z0-1 (P30-L425)

51166  [NCBI]

Full Length of Mature Protein

PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.