Alkaline Phosphatase/ALPI Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The ALPI protein, an alkaline phosphatase enzyme, hydrolyzes phosphate compounds, demonstrating enzymatic activity in breaking down different phosphate molecules. Alkaline Phosphatase/ALPI Protein, Rat (HEK293, His) is the recombinant rat-derived ALPI protein, expressed by HEK293 , with N-10*His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ALPI protein, an alkaline phosphatase enzyme, hydrolyzes phosphate compounds, demonstrating enzymatic activity in breaking down different phosphate molecules. Alkaline Phosphatase/ALPI Protein, Rat (HEK293, His) is the recombinant rat-derived ALPI protein, expressed by HEK293 , with N-10*His labeled tag.
Background
ALPI protein is an alkaline phosphatase enzyme that possesses the capability to hydrolyze a range of phosphate compounds. It exhibits the ability to break down various phosphate molecules through its enzymatic activity.
Verified Bioactivity
Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-pbenylphosphate (pNPP), in 1 minute at 37°C, pH 10.0. The specifc activity is 10000 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag N-10*His
-
Accession
P15693 (V21-N511)
-
Molecular Construction
-
N-term
-
10*His
-
ALPI (V21-N511)
Accession # P15693 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ALPI; Intestinal-Type Alkaline Phosphatase; Alkaline Phosphatase, Intestinal; Alkaline Phosphomonoesterase; IAP; Glycerophosphatase; Intestinal Alkaline Phosphatase; Kasahara Isozyme
-
AA Sequence
VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN
-
Predicted Molecular Mass
55.9 kDa
-
Molecular Weight
Approximately 65-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
