Annexin A5/ANXA5 Protein, Human

Customer Review

Based on 1 Customer Validation

Annexin A5 Protein, Human is a 35 kDa multifunctional protein which belongs to the annexin family. Annexin A5 induces in vitro fusion and aggregation of vesicles in a Ca2+- and acidic-pH-dependent manner.Annexin A5 is accepted as an early marker of apoptosis. Annexin A5 has anti-thrombotic and anti-microbial properties.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Annexin A5 Protein, Human is a 35 kDa multifunctional protein which belongs to the annexin family. Annexin A5 induces in vitro fusion and aggregation of vesicles in a Ca2+- and acidic-pH-dependent manner.Annexin A5 is accepted as an early marker of apoptosis. Annexin A5 has anti-thrombotic and anti-microbial properties[1].

Background

The Annexins comprise a family of proteins that are involved in many aspects of cellular membrane dynamics and the regulation of membrane-associated proteins.
Recombinant Human Annexin A5 is a Ca2+-sensitive protein that binds to negatively charged phospholipids, establishing specific interactions with other lipid microdomains[1].
Recombinant Human Annexin A5 promotes delivery of autophagosomes to lysosomes and inhibits endocytosis. Annexin A5 emerges as a possible positive regulator of autophagy and negative regulator of endocytosis through Ca2+ and phospholipid signalling pathways[1][1].

Verified Bioactivity

Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 0.1-0.5 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 0.1537 μg/mL. Corresponding to a specific activity is 6506.181 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ANXA5 (A2-D320)
      Accession # P08758
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    ANXA5; RPRGL3; Prev. ANX5; Thromboplastin Inhibitor; Prev. ENX2; Anchorin CII; CPB-I; Lipocortin V; PAP-I; VAC-Alpha; Placental Anticoagulant Protein I; Annexin-5; Vascular Anticoagulant-Alpha; PP4; Calphobindin I; Epididymis Secretory Protein Li 7; Endon

  • AA Sequence

    AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

  • Predicted Molecular Mass

    35.8 kDa

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00