Copy Link Print Information

AP-2 gamma/TFAP2C Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • AP-2 gamma/TFAP2C Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Background

AP-2 gamma/TFAP2C protein serves as a sequence-specific DNA-binding factor, engaging with inducible viral and cellular enhancer elements to intricately regulate transcription of specific genes. Recognizing the consensus sequence 5'-GCCNNNGGC-3', AP-2 gamma activates genes crucial for diverse biological functions, spanning proper eye, face, body wall, limb, and neural tube development. Simultaneously, it exerts a suppressive influence on several genes, including MCAM/MUC18, C/EBP alpha, and MYC. This protein also plays a pivotal role in the MTA1-mediated epigenetic control of ESR1 expression in breast cancer. Operating as a dimer, AP-2 gamma can form homodimers or heterodimers with other members of the AP-2 family. Notably, it engages in various protein interactions, including those with WWOX, CITED4, UBE2I, KCTD1, CITED2, and MTA1, each contributing to the complex regulatory network governing transcriptional activity.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His
  • Accession

    Q92754-1 (L128-V223)

  • Gene ID
    7022  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • AP-2γ (L128-V223)
      Accession # Q92754
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TFAP2C; Activating Enhancer-Binding Protein 2 Gamma; Transcription Factor AP-2 Gamma; Estrogen Receptor Factor 1; AP2-GAMMA; Transcription Factor ERF-1; TFAP2G; Transcription Factor AP-2 Gamma (Activating Enhancer-Binding Protein 2 Gamma); HAP-2g; AP2-Gam

  • AA Sequence

    LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

  • Molecular Weight

    Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • AP-2 gamma/TFAP2C Protein, Human (His) Product Image
    1/16
  • AP-2 gamma/TFAP2C Protein, Human (His) Product Image