1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. APJ Protein-VLP, Human (HEK293)

APJ Protein-VLP, Human (HEK293) is the recombinant human-derived APJ protein, expressed by HEK293, with tag free tag.It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

APJ Protein-VLP, Human (HEK293) is the recombinant human-derived APJ protein, expressed by HEK293, with tag free tag.It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236.

Background

APJ is a G protein-coupled receptor that binds peptide hormones apelin (APLN) and apelin receptor early endogenous ligand (APELA/ELA), playing a central role in regulating normal cardiovascular function and fluid homeostasis. As an apelin receptor, it activates both the G(i) protein pathway (inhibiting adenylate cyclase activity) and the beta-arrestin pathway (promoting receptor internalization). APLNR/APJ also functions as a mechanoreceptor, activated by pathological stimuli in a G-protein-independent manner to induce beta-arrestin signaling, thereby triggering cardiac hypertrophy, though apelin ligand presence blunts this pathological induction. During early development, it acts as an APELA receptor in gastrulation, blood vessel formation, and heart morphogenesis (by similar). It may promote angioblast migration toward the embryonic midline (future vessel formation site) (by similar) and drive sinus venosus (SV)-derived endothelial cell migration into the developing heart to support coronary vessel development (by similar). In adults, it further regulates blood vessel formation, blood pressure, heart contractility, and heart failure.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P35414 (M1-D380)

Gene ID

187

Molecular Construction
N-term
APJ (M1-D380)
Accession # P35414
C-term
Protein Length

Full Length

Synonyms
AGTRL1; APJ
AA Sequence

MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD

Predicted Molecular Mass
46.7 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by HPLC.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

APJ Protein-VLP, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

APJ Protein-VLP, Human (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APJ Protein-VLP, Human (HEK293)
Cat. No.:
HY-P704094
Quantity:
MCE Japan Authorized Agent: