APJ Protein-VLP, Human (HEK293)
APJ Protein-VLP, Human (HEK293) is the recombinant human-derived APJ protein, expressed by HEK293, with tag free tag.It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
APJ Protein-VLP, Human (HEK293) is the recombinant human-derived APJ protein, expressed by HEK293, with tag free tag.It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236.
Background
APJ is a G protein-coupled receptor that binds peptide hormones apelin (APLN) and apelin receptor early endogenous ligand (APELA/ELA), playing a central role in regulating normal cardiovascular function and fluid homeostasis. As an apelin receptor, it activates both the G(i) protein pathway (inhibiting adenylate cyclase activity) and the beta-arrestin pathway (promoting receptor internalization). APLNR/APJ also functions as a mechanoreceptor, activated by pathological stimuli in a G-protein-independent manner to induce beta-arrestin signaling, thereby triggering cardiac hypertrophy, though apelin ligand presence blunts this pathological induction. During early development, it acts as an APELA receptor in gastrulation, blood vessel formation, and heart morphogenesis (by similar). It may promote angioblast migration toward the embryonic midline (future vessel formation site) (by similar) and drive sinus venosus (SV)-derived endothelial cell migration into the developing heart to support coronary vessel development (by similar). In adults, it further regulates blood vessel formation, blood pressure, heart contractility, and heart failure.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P35414 (M1-D380)
-
Gene ID187
-
Molecular Construction
-
N-term
-
APJ (M1-D380)
Accession # P35414 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
APLNR; APJ (Apelin) Receptor; Prev. AGTRL1; G Protein-Coupled Receptor APJ; APJ; G-Protein Coupled Receptor APJ; APJR; HG11 Orphan Receptor; G-Protein Coupled Receptor HG11; APJ Receptor; Angiotensin II Receptor-Like 1; HG11; Angiotensin Receptor-Like 1;
-
AA Sequence
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
-
Predicted Molecular Mass
46.7 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by HPLC.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)