Apolipoprotein A-V/APOA5 Protein, Mouse (His)

Apolipoprotein AV (APOA5) is primarily associated with HDL and VLDL, affecting triglyceride (TG) levels. APOA5 stimulates apo-CII lipoprotein lipase (LPL) TG hydrolysis and inhibits hepatic VLDL-TG production without affecting VLDL-apoB production. Apolipoprotein A-V/APOA5 Protein, Mouse (His) is the recombinant mouse-derived Apolipoprotein A-V/APOA5 protein, expressed by E. coli , with N-His labeled tag.

Apolipoprotein A-V (APOA5) is a minor apolipoprotein primarily associated with HDL and, to a lesser extent, with VLDL, and may also be linked to chylomicrons. It plays a crucial role in regulating plasma triglyceride (TG) levels, acting as a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and as an inhibitor of the hepatic VLDL-TG production rate, without affecting the VLDL-apoB production rate. APOA5 activates lecithin:cholesterol acyltransferase (LCAT) poorly and does not enhance cholesterol efflux from macrophages. Additionally, it exhibits binding affinity for heparin and interacts with GPIHBP1. Furthermore, APOA5 engages in an interaction with SORL1, influencing its internalization and sorting, either to lysosomes for degradation or to the trans-Golgi network.

Mouse

E. coli

N-8*His

Q8C7G5 (R21-G368)

66113  [NCBI]

Full Length of Mature Protein

RKSLWDYFSQNSWSKGVMGQPQKLAQENLKGSFEQDLYNMNNYLEKLGPLRGPGKEPPLLAQDPEGIRKQLQQELGEVSSRLEPYMAAKHQQVGWNLEGLRQQLKPYTAELMEQVGLSVQELQEQLRVVGEDTKAQLLGGVDEALNLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAPHAAASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSAFIRVSTDGAEDGDSLDPQALSEEVRQRLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAYGLQDQGHSHLSDPEGHSG

Approximately 40.5 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, 2 mM DTT, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.