1. Recombinant Proteins
  2. Others
  3. Apolipoprotein A-V/APOA5 Protein, Mouse (His)

Apolipoprotein AV (APOA5) is primarily associated with HDL and VLDL, affecting triglyceride (TG) levels. APOA5 stimulates apo-CII lipoprotein lipase (LPL) TG hydrolysis and inhibits hepatic VLDL-TG production without affecting VLDL-apoB production. Apolipoprotein A-V/APOA5 Protein, Mouse (His) is the recombinant mouse-derived Apolipoprotein A-V/APOA5 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein AV (APOA5) is primarily associated with HDL and VLDL, affecting triglyceride (TG) levels. APOA5 stimulates apo-CII lipoprotein lipase (LPL) TG hydrolysis and inhibits hepatic VLDL-TG production without affecting VLDL-apoB production. Apolipoprotein A-V/APOA5 Protein, Mouse (His) is the recombinant mouse-derived Apolipoprotein A-V/APOA5 protein, expressed by E. coli , with N-His labeled tag.

Background

Apolipoprotein A-V (APOA5) is a minor apolipoprotein primarily associated with HDL and, to a lesser extent, with VLDL, and may also be linked to chylomicrons. It plays a crucial role in regulating plasma triglyceride (TG) levels, acting as a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and as an inhibitor of the hepatic VLDL-TG production rate, without affecting the VLDL-apoB production rate. APOA5 activates lecithin:cholesterol acyltransferase (LCAT) poorly and does not enhance cholesterol efflux from macrophages. Additionally, it exhibits binding affinity for heparin and interacts with GPIHBP1. Furthermore, APOA5 engages in an interaction with SORL1, influencing its internalization and sorting, either to lysosomes for degradation or to the trans-Golgi network.

Species

Mouse

Source

E. coli

Tag

N-8*His

Accession

Q8C7G5 (R21-G368)

Gene ID
Molecular Construction
N-term
8*His
APOA5 (R21-G368)
Accession # Q8C7G5
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Apolipoprotein A-V; Apo-AV; ApoA-V; Apolipoprotein A5; Apoa5; Rap3
AA Sequence

RKSLWDYFSQNSWSKGVMGQPQKLAQENLKGSFEQDLYNMNNYLEKLGPLRGPGKEPPLLAQDPEGIRKQLQQELGEVSSRLEPYMAAKHQQVGWNLEGLRQQLKPYTAELMEQVGLSVQELQEQLRVVGEDTKAQLLGGVDEALNLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAPHAAASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSAFIRVSTDGAEDGDSLDPQALSEEVRQRLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAYGLQDQGHSHLSDPEGHSG

Molecular Weight

Approximately 40.5 kDa

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, 2 mM DTT, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Apolipoprotein A-V/APOA5 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Apolipoprotein A-V/APOA5 Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein A-V/APOA5 Protein, Mouse (His)
Cat. No.:
HY-P77872
Quantity:
MCE Japan Authorized Agent: