Apolipoprotein A-V/APOA5 Protein, Mouse (His)
Based on 1 Customer Validation
Apolipoprotein AV (APOA5) is primarily associated with HDL and VLDL, affecting triglyceride (TG) levels. APOA5 stimulates apo-CII lipoprotein lipase (LPL) TG hydrolysis and inhibits hepatic VLDL-TG production without affecting VLDL-apoB production. Apolipoprotein A-V/APOA5 Protein, Mouse (His) is the recombinant mouse-derived Apolipoprotein A-V/APOA5 protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Apolipoprotein AV (APOA5) is primarily associated with HDL and VLDL, affecting triglyceride (TG) levels. APOA5 stimulates apo-CII lipoprotein lipase (LPL) TG hydrolysis and inhibits hepatic VLDL-TG production without affecting VLDL-apoB production. Apolipoprotein A-V/APOA5 Protein, Mouse (His) is the recombinant mouse-derived Apolipoprotein A-V/APOA5 protein, expressed by E. coli , with N-His labeled tag.
Background
Apolipoprotein A-V (APOA5) is a minor apolipoprotein primarily associated with HDL and, to a lesser extent, with VLDL, and may also be linked to chylomicrons. It plays a crucial role in regulating plasma triglyceride (TG) levels, acting as a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and as an inhibitor of the hepatic VLDL-TG production rate, without affecting the VLDL-apoB production rate. APOA5 activates lecithin:cholesterol acyltransferase (LCAT) poorly and does not enhance cholesterol efflux from macrophages. Additionally, it exhibits binding affinity for heparin and interacts with GPIHBP1. Furthermore, APOA5 engages in an interaction with SORL1, influencing its internalization and sorting, either to lysosomes for degradation or to the trans-Golgi network.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-8*His
-
Accession
Q8C7G5 (R21-G368)
-
Molecular Construction
-
N-term
-
8*His
-
APOA5 (R21-G368)
Accession # Q8C7G5 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APOA5; APOA-V; Apolipoprotein A5; Apo-AV; Apolipoprotein A-V; ApoA-V; RAP3; APOAV; Regeneration-Associated Protein 3
-
AA Sequence
RKSLWDYFSQNSWSKGVMGQPQKLAQENLKGSFEQDLYNMNNYLEKLGPLRGPGKEPPLLAQDPEGIRKQLQQELGEVSSRLEPYMAAKHQQVGWNLEGLRQQLKPYTAELMEQVGLSVQELQEQLRVVGEDTKAQLLGGVDEALNLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAPHAAASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSAFIRVSTDGAEDGDSLDPQALSEEVRQRLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAYGLQDQGHSHLSDPEGHSG
-
Predicted Molecular Mass
40.5 kDa
-
Molecular Weight
Approximately 41 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, 2 mM DTT, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
