Apolipoprotein E/APOE Protein, Rabbit (His-B2M, Myc)

Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-B2M, Myc) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, C-Myc, N-B2M labeled tag.

APOE is a protein that plays a crucial role in the transport of lipids between organs through plasma and interstitial fluids. It is a key component of various lipoproteins, including chylomicrons, VLDL, IDL, and HDL. APOE binds to a wide range of cellular receptors, such as LDLR and VLDLR, facilitating the uptake of lipoprotein particles. Additionally, APOE has a heparin-binding activity and interacts with heparan-sulfate proteoglycans on cell surfaces, supporting the capture and uptake of lipoproteins. It forms a homotetramer and can interact with ABCA1 in the formation of HDLs. APOE may also interact with other proteins like APP/A4 amyloid-beta peptide, MAPT, MAP2, secreted SORL1, and PMEL for various physiological processes.

Rabbit

E. coli

N-10*His;C-Myc;N-B2M

P18287 (T20-Q311)

100009337  [NCBI]

Full Length of Mature Protein

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Approximately 55 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.